CAZyme Information: MGYG000001024_00641

Basic Information

• Species: HGM11521 sp900751885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11521; HGM11521 sp900751885
• CAZyme ID: MGYG000001024_00641
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1107		125765.08	5.0029

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001024	2614111	MAG	Sweden	Europe

• Gene Location: Start: 136163; End: 139486 Strand: -

Full Sequence      

MIVKKVTEDMIFQERQAEKSLGGEYNFNYQWHFKLANAFPLKEAICQNRDKTGHFFYETD
YREEEWEEVSLPHTFNDKDLFVSRISDAGSGQKRTFALYRKWFCLPKEHSGKKVIIEFEG
IRQTCYCYVNGRMAGFYEAGVGPFAFDVTAYIQDGDNLIAIATDNTSSRDLDYFAAETPN
MEGAEPGSFYASLTEEERIPKEHRGVRHFWNCNDFNPSVGGLSKNITLHIKPQLYLTLPI
YSNLRTKGTYIYGSDYCISQKQAVIHIEAEIRNETGAPVDALVQSHIYDAQGNLVGAVTS
EAETIKPAEGVPKYPEHTVTPKDAYRKTEEGYFPAPEDEVSPIDTQTPNVSVIAAKKEIG
NLRFWSIDDPYLYTVVTNLICNGTVVDSIKTVTGFRKASYDGREGLKINDVQVWLTGYAQ
RAANEWAVIGVPTDWLRDYDATLIRESNANHLRFMHVAACPADIRSCDRYGIICTQPAGD
KEQENFGRQWNQRMELMRDIIIYFRNNPSIVFWEAGNNSINQEHMRQMRLLKEKLDPSGG
RFMGCRTINTEEVVEEAEYVGTMLNRHAARFQSERMPVTETEYSRDEAPRRVWDDFSPPN
FDYDNRWLGRGGRKQVGGDCYDLTAEEFALHTAKGYSEFFNDRIGGPGKNLYSAAAALCW
TDSAQHGRQAFSENARMSGRVDAVRIKKQSFDVFQTLQSPCPKVKIIGHWNYPKEEGDNY
RYAKKVFNGVFWEKTAEYGYRDPKHKTVYVIGSYEIGRVELFVNGKLVGVCTEPENSFIF
PFQDIDVTKSGNILAKGYDYHGNVVAEDWIETAGKPANIRLTAHTGTRGLLADGADVAFV
DVEVVDQDGRLCPLCYDRIDFSFEGNGVFLGGYNSGRFDGYGRDDSVIHQMYVYAECGNN
RVFIRSTFEAGTIRLRASMKGLPVSEITLKSKEAARDTLAKEFPQYIEPCYEEYSPISVY
RYEAIPEADAAKYVPEDKVYCKVLVDGQEPDTRGVLSIYDHESVYSPILYILKRIKEKRA
ELFDYEYDESTAVLTIKTKEHTVIAEKGRTHLLVDGEENLMGGEPYVKEDGTFIVEINAV
ASYIPGVTSCYDEKVNVFRIELMDDIG

Enzyme Prediction     

No EC number prediction in MGYG000001024_00641.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	20	539	2.4e-64	0.4800531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18565	Glyco_hydro2_C5	3.63e-19	819	928	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
COG3250	LacZ	1.85e-17	27	544	15	432	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02837	Glyco_hydro_2_N	3.76e-12	19	167	2	137	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PRK10340	ebgA	1.09e-10	98	538	112	469	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	8.53e-10	258	396	13	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASA20342.1	0.0	25	1102	11	1088
QGH35456.1	0.0	25	1102	19	1097
AGT88372.1	1.47e-201	25	931	3	791
ADJ49535.1	1.47e-201	25	931	3	791
QMV17606.1	1.73e-170	26	935	51	861

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	2.60e-141	25	931	38	804	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
7CWD_A	1.12e-44	26	935	5	805	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	9.68e-41	26	922	11	798	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
4CU6_A	3.06e-33	26	929	17	842	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU7_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU8_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4]
4CUC_A	7.04e-33	26	929	17	842	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	1.14e-140	25	931	29	795	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	6.90e-41	26	933	46	850	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
P77989	2.49e-27	57	932	23	739	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	5.18e-21	66	517	79	429	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
A5F5U6	2.39e-13	14	538	36	479	Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001024_00641.