CAZyme Information: MGYG000001024_00689

Basic Information

• Species: HGM11521 sp900751885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11521; HGM11521 sp900751885
• CAZyme ID: MGYG000001024_00689
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1582	MGYG000001024_34|CGC1	171565.32	4.2976

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001024	2614111	MAG	Sweden	Europe

• Gene Location: Start: 92946; End: 97694 Strand: +

Full Sequence      

MNIIRRILAAAVSLSIMAAAVPAVLAAQGNTPPAQPIGLLTNELEQPLNVEGAPYFSWLL
QDEDDNELQTAYQIVVTDAISKEEVWDSDQTTSTEQSYVAYAGPALEEAHPYTWKVRTWD
KDGEPSPYSEESEFATGLTDDSWNASWIAPANAKGKNIFWHTRKEQPLAEGKAVTCALAY
VAGCHDYELNINGVRLGRGQSFDYPDMTDYQAWDITEAVGGSSSIAVGILARWYGGGQGR
APGQIGLLAHIKLFYEDGTTEVIATDDTWKTAAAPFYGETARNGEGDFVEKYDAQKQQEN
WTRTGYNDSAWAQAAELGVHPSAPFTHVEAELGHVTEYEVKPVSVRKIADGSTVADFGKV
IPARLLIHFENGTAGNEFAIQTGYEVDNSGAINTNKTSLQDTDMRFVYTQKDGEQTYHSW
DHLGFRYVQIPAGAGQDFAEEDISALVVHAEVPRDRDTHFLSSNEMLNQVYELMKRSSLY
SAQNSFVDTPTREKGQFLDDGTNISAATTTTWYERTTTKKALLQFLDSADRYWNEGNDLG
RYNAVYPNSDGKRDIPEYSIDFPVWVWRYYMQTGDRDLLEKAYPYMKNTADYITRNIATA
GASAGLVTAIEGGSSSYLQGIVDWPASGRFGYDWNGTKDGVRTTINALSVRTFDTIAAMA
MELGEESEATDLQAKAQSLRNAMNEKLINSAGVYSDGLNKDGNQVSHAGQHSTSYALAFD
IAPDEKKQHMADYVAGMGMRQGPMTADILAESLFDTGLSKDALKLFTNSNDYGWAMLVDR
GYTFTWESWGDGSKATDSQSHGWGSAAARLILEHFAGVTVTEAGAKKIMITPAYGVLDSV
DASVMTERGRVGVAYSGRKAEFEMTVSVPVNVQAQIVLPQIGTGEFIDADGAVLQSEMSN
GSQVVTVGSGTYHLIYDGEATTAVTIENPEGIRAHAVIGGRNYPLPMQENIASDDMGTLQ
VVSDDENYTFAYFTGDVVSAHTPPVNLLEDSVSLLTHFKYQGVPTGQDTATLHIGGSEGM
VRINGIEQSIPYDASFVKGTELTVEPVAPEGKVFTGFTGDGLIGTPALVVMNSDIQADVS
FAENGEIELVSKGKAVTASSSLENDSWGKAKLTDGMTTGTGYSSNDSYNSADVSANPPYV
EIDLGSVMPVDSVVLYPRTDESAIKAGHYMFPQDFSVAVSEDGNSGTYQTVQTVTGAADD
ALPDKITFDTVNARYVRVTFTKLCEDTTLGNRRLQLAEMEVYSGEVSKTLVHEIVLGQTD
VQLALGDTITLSASVLPVVADEKEVEWLVHDIDGEGYGVVSKKAELVTRSGGAEVIPLEA
GTVDVVARARDGSGVIAICRVDIVSLGNKVTIDKSSVTKEALSYDVTVSGAGTLFTAVYS
QDGELLTVKTDGIQKRTSLKKTIPVAEMMTEGVTKFMLWDSGEDMKPISVYAQSSWDLSR
PDMIWDLRSIVSSRTTMNTFENNTKEYEGIWIVGGGESDYLDPQEGFYTRGKSGTGAGAN
RYIKYTAPYDGVMEITAKRSYSGASLWVTTSAQLSGGAVVEHLSNNDSFATGSVPMEEGA
TYYFYCVGSGMTMQSLRFSAAY

Enzyme Prediction     

No EC number prediction in MGYG000001024_00689.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	345	878	7.2e-98	0.998015873015873
CBM67	145	324	2.6e-33	0.9886363636363636
CBM32	1097	1239	1.2e-17	0.9354838709677419

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.00e-25	460	801	6	324	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	6.90e-22	172	317	1	153	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam00754	F5_F8_type_C	4.83e-17	1095	1222	1	114	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam17390	Bac_rhamnosid_C	1.13e-06	817	879	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	7.31e-06	346	449	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVT31771.1	5.98e-244	15	910	24	917
AVT37928.1	1.18e-243	15	910	24	917
ASO20813.1	1.49e-238	30	881	34	883
SCF06921.1	1.67e-238	22	910	35	921
APU21677.1	4.88e-238	30	881	35	884

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.43e-53	36	913	32	938	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.11e-42	44	912	14	1026	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
2OKX_A	2.03e-11	142	349	5	212	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	3.39e-46	39	917	35	950	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	5.88e-42	44	912	14	1026	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	3.85e-38	51	879	48	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KM26	6.00e-06	54	141	491	581	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000300	0.998964	0.000170	0.000220	0.000178	0.000146

TMHMM  Annotations     

start	end
7	29