CAZyme Information: MGYG000001024_00989

Basic Information

• Species: HGM11521 sp900751885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11521; HGM11521 sp900751885
• CAZyme ID: MGYG000001024_00989
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
700		78654.33	4.996

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001024	2614111	MAG	Sweden	Europe

• Gene Location: Start: 55124; End: 57226 Strand: +

Full Sequence      

MKRPILILLLITLLTTYTLPLVSAAPPSPSASPTPAASMSPNPSPSAHPTPSSKPTQTPS
PTPTPEPAPDLMQSGLTPELQAAFETLFTACAIAKNKKDDRAVIRTCEDMVSFLREMNQT
EQIKDLIAHYLEQAAWSYEHIGDYISAGKKYIDYLPLSTHFGWTDGSKIARAKIAQYMPS
MEVYTDTYDTQCYYGAKHEPQKGTLYGEVVDEYLPGDTFQDSMLLYYLEYGDTDTTWLKE
ALELARRDHLAVEFAWNFPKQGAQCSEVPKDTTYINNIIRVLNQYTDVKIFLRIGAEMNI
WDEQTSPEEFKAAFIHIAKLVKNQTKHVALVWSVNQVSSWDVEMNDYYPGDEYVDWVGVS
AYAQKYFLGRKDWKPEEKFNEVVFLTGNSADPVKALTEVIQKYGHKKPIMLAECGVSHKI
RPLKEDATAWASTQLRRMYAYVPMVYPQVKLIAYFNHEMEGETNDYCLWRNPTIAAAYNK
ATQASHFIHGNADSEPESVYQKFWDGIYVEQSYLPVYTYAHIWGDDEPTVQYYIDSTLTG
TSKELPYRMELDIHGLSLGEHTLRTVVTGKNGIKTEKTYCFTVIPPLSLVVDGAAVTGDV
GPVLEDGTTLVPVRAVSEILGADVQWDGEAQMVTIQKGGDTVTMKIGSRTAEKNGKQVKI
DLPPRLVKGRTIVPLRTIAEMLGAEVDWNEENRVISIAQL

Enzyme Prediction     

No EC number prediction in MGYG000001024_00989.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	273	432	2.4e-22	0.4521452145214521

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07833	Cu_amine_oxidN1	5.92e-37	605	697	1	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam07833	Cu_amine_oxidN1	1.23e-11	589	635	47	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
PRK14696	tynA	4.69e-08	610	687	1	78	primary-amine oxidase.
COG4124	ManB2	1.11e-05	288	415	180	296	Beta-mannanase [Carbohydrate transport and metabolism].
pfam02156	Glyco_hydro_26	3.58e-05	274	367	135	235	Glycosyl hydrolase family 26.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAD39558.1	1.29e-67	124	697	8	586
AUO19576.1	2.07e-64	179	697	48	579
AMJ39775.1	1.24e-61	94	582	44	533
AFH64572.2	1.29e-55	197	697	177	669
AFC32267.1	1.29e-55	197	697	177	669

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000314	0.998957	0.000206	0.000170	0.000156	0.000142

TMHMM  Annotations     

start	end
5	27