CAZyme Information: MGYG000001024_01261

Basic Information

• Species: HGM11521 sp900751885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11521; HGM11521 sp900751885
• CAZyme ID: MGYG000001024_01261
• CAZy Family: GH42
• CAZyme Description: Beta-galactosidase BgaP

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658		75898.22	5.9422

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001024	2614111	MAG	Sweden	Europe

• Gene Location: Start: 37431; End: 39407 Strand: +

Full Sequence      

MLFGVAYYPEHWDKKDWKRHARLMREGNFNVARIAEFAWGRIEPEEDRFDFAWLDEAIDT
LAAEGINVILGTPTASPPKWLADKYDVYLRDRYGRARGFGSRRQCCSNHPDYIERSIRVV
EKMAEHYKDHPNVIAWQIDNEFGCHGSTQCYCEHCKQAFSRWLEARYHDITALNTLYGTV
FWSQEYRGFDDVILPAYTSCEPECGHSWAHNPSLDMDFYRFSSDSWVNYQQLQIDIIRKY
SGAPITHNMMGHFSDIDYNKLGKPLDIVSWDNYIDNQWNHETYENTSMAHELMRGVKNQN
FWIVEQQSGQCGWDMYGGTPRPGQLRLWTYQAIAHGCEGLLYFRFKSVPFGMEQYWHGVI
DHDGIPRRRYAELQQTGAELKHLAPLFMGAQSKTDVLIVKSYEHVWSHAIKQHKKEFDYR
ELLYAYYKANNHLGTNPACGSEEMISSQYQIVYLPACIIVSEALEKRLEEYVMGGGCLVL
TYRSGIKDENNNICTSTMPGRLRKLSGVTVEEFDTSPVQTALSGGFGSTGVWRDILKTET
AQTAATYESEYYKGSAAITRNQYGKGTVWYVGCDLTDDALFRLVKTITEKAGVQYMPHPE
GTEIIRRSADNAEYTMLLNYTDEEKEMQIRGTSLFDGKPFDGRLGAYSVAIIEDRENK

Enzyme Prediction     

No EC number prediction in MGYG000001024_01261.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	7	381	1.3e-144	0.9919137466307277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	5.45e-161	7	383	2	376	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	3.89e-133	1	652	16	670	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam08532	Glyco_hydro_42M	1.22e-49	395	593	2	206	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.
cd03143	A4_beta-galactosidase_middle_domain	1.28e-20	396	593	1	154	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
pfam01301	Glyco_hydro_35	1.96e-07	17	163	26	171	Glycosyl hydrolases family 35.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJG98277.1	3.00e-244	1	653	1	672
ANE47075.1	2.03e-238	1	652	1	668
AZN39823.1	1.26e-187	1	653	1	657
QGQ95545.1	4.44e-187	1	629	1	634
AGB41273.1	3.38e-173	1	642	1	652

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KWG_A	7.53e-133	2	654	1	644	Crystalstructure of Thermus thermophilus A4 beta-galactosidase [Thermus thermophilus],1KWK_A Crystal structure of Thermus thermophilus A4 beta-galactosidase in complex with galactose [Thermus thermophilus]
6LVW_A	4.86e-129	1	653	1	688	PolyextremophilicBeta-galactosidase from the Antarctic haloarchaeon Halorubrum lacusprofundi [Halorubrum lacusprofundi ATCC 49239]
3TTS_A	1.62e-126	1	653	9	673	ChainA, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_A Chain A, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus]
6Y2K_A	5.44e-120	1	651	1	652	ChainA, beta-galactosidase [Marinomonas sp. ef1]
4OIF_A	8.53e-94	1	655	15	685	3Dstructure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus],4OIF_B 3D structure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus],4OIF_C 3D structure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94804	9.52e-139	1	635	1	636	Beta-galactosidase BgaH OS=Haloferax lucentense (strain DSM 14919 / JCM 9276 / NCIMB 13854 / Aa 2.2) OX=1230452 GN=bgaH PE=1 SV=2
Q8GEA9	2.07e-132	2	654	1	644	Beta-galactosidase BgaA OS=Thermus sp. OX=275 GN=bgaA PE=1 SV=1
O69315	4.12e-132	2	654	1	644	Beta-galactosidase OS=Thermus thermophilus OX=274 PE=1 SV=1
Q9X6C6	1.16e-131	2	654	1	644	Beta-galactosidase BgaT OS=Thermus brockianus OX=56956 GN=bgaT PE=1 SV=1
Q09HN2	2.22e-130	4	630	12	646	Beta-galactosidase BgaP OS=Planococcus sp. (strain L4) OX=377621 GN=bgaP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000010	0.000054	0.000003	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001024_01261.