CAZyme Information: MGYG000001025_00312

Basic Information

• Species: Collinsella sp900768795
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900768795
• CAZyme ID: MGYG000001025_00312
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
845		90247.5	9.9983

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001025	1331709	MAG	Sweden	Europe

• Gene Location: Start: 10784; End: 13321 Strand: +

Full Sequence      

MNKTTKALQIVFASAECAPFVKTGGLGDVAGSLPAALTRAGAECIVMVPKYSTIKSEYTD
QMEHLTDFYVPLGWRNEYCGLEKLESDGVTYLFIDNERYFKRDYPYGHFDDGERFAFFAK
AVTESLQHLPEGFECDVLHCNDWQTALSPVFLREFYQGIPLYDRVRTVFSIHNVAFQGQF
TDKLLNDILGLAHIPAAAAQLRCDSRSINYMLGGLHYTDAITTVSPTYAGEIQTPEYGEG
LDGILRDRSYVLQGILNGIDTKAFDPATDKRIAANYSEKNMSGKATCKAKLQEELGLEVR
DDRPLMVMVTRLTRQKGLDLVMYSLDRILSNGVQVAVLGTGDADYEDGLRWFQSQYPGSM
AARIEFDPALSQRMYAGADMFLMPSKFEPCGLSQIISMRYGTLPIVRETGGLKDTVIPYN
QFTGEGTGFSFTHFNGDEMGDAVFRAARLFWDDKDSWNALVRNAMEQDFSWTRSANTYID
LYLNLHPDVREEEDRLKAEKAEAEKKAAEEAAKKAEAEKKAAEQAAKEATKKAEAEKKAA
KEAAKKAEAEKKAAALKAESPKKTAAEKKTSVKTAATANDAESRLKSVAAKPAAKTAAAE
KNPATSKPAAKHAKKTTAKAKPATKSEPAHAATAMATESKTAASEEPEPKIAQGTKPAAH
KPAHMAKPKAPASPAPTATSKAATTAAASTVKPTAKSTAVKAAPAKTASAKTAGAKKRTA
KPKAAATKSTARTKSAAAKTVTVKTVSKTAAAKTTSAKTASPAKSVSTTKTAAKKTTAAA
KATKTATAAPKSDSAPTASTAKSATASKSVAASAAAAPAKKPAAKNVHAAQTSVKSKAKG
TSRRA

Enzyme Prediction     

No EC number prediction in MGYG000001025_00312.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	9	482	1.1e-179	0.9936440677966102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0297	GlgA	0.0	9	482	2	475	Glycogen synthase [Carbohydrate transport and metabolism].
PRK00654	glgA	0.0	8	485	1	463	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	9	484	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
TIGR02095	glgA	0.0	8	485	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK14099	PRK14099	4.87e-131	6	485	2	479	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34705.1	1.87e-304	8	489	1	482
ATP54860.1	2.97e-304	8	489	1	482
AZH70577.1	1.25e-302	8	504	1	502
AEB07181.1	1.91e-272	6	485	4	483
QWT18297.1	4.86e-251	8	488	1	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	4.25e-90	8	485	1	476	ChainA, Glycogen synthase [Escherichia coli]
1RZU_A	2.03e-89	8	485	1	475	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
2QZS_A	2.84e-89	8	485	1	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	2.10e-88	8	485	1	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
4HLN_A	7.29e-87	1	482	120	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6M334	5.89e-163	8	485	1	475	Glycogen synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) OX=290402 GN=glgA PE=3 SV=1
A0PY73	1.17e-159	8	485	1	475	Glycogen synthase OS=Clostridium novyi (strain NT) OX=386415 GN=glgA PE=3 SV=1
B2TR28	8.96e-159	8	485	1	475	Glycogen synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=glgA PE=3 SV=1
B2V049	2.52e-158	8	485	1	475	Glycogen synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=glgA PE=3 SV=1
C4L3L1	4.86e-158	8	482	1	473	Glycogen synthase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) OX=360911 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999935	0.000083	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001025_00312.