CAZyme Information: MGYG000001029_00251

Basic Information

• Species: CAG-217 sp000436335
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-217; CAG-217 sp000436335
• CAZyme ID: MGYG000001029_00251
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
817	MGYG000001029_4|CGC1	89108.86	4.7783

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001029	1961725	MAG	Sweden	Europe

• Gene Location: Start: 24091; End: 26544 Strand: +

Full Sequence      

MKHADIVNKMSLEQKAAFVSGFDYWHLEEAPELGLPKIMVTDGPHGLRKQNPNGDSVGLG
NSYPATCFPTAATSSCSWDEELLRKEGEALGEECLQEEVSVILGPGTNIKRAPVCGRNFE
YFSEDPYLAGKCSANIINGVQSKGIGTSLKHFACNSQEAYRMVINEVIDERAMREIYLTA
FEIAIKEAQPWTVMNSYNRINGVYASQNGWLQQQVARGEWGFQGLFVTDWGSSVDRIPGL
ENGTDLEMPSSGDLNTQRIIAAVKEGKLDENVLNERVDNVVNLILKAKKTLDEGKKTYDV
DAHHDLACRVAEGSIQLLKNDDGLLPLKKGQKVAVIGEMAKAPRYQGAGSSVINPTKMEN
AYDNLVELGVDVTYAQGYKKGTEQVDDALVAEALAAAKAADVAVVFAGLTEEFEGEGYDR
ANIEMPANHNQLIEQVAAANPNTVVVLAGGSVIHMPWLNSAKALLNSGLSGQAGGKAVAR
ILTGAVCPSGKTSETYPLSFEDNPTYGNYPGQPVVSEHKESVYIGYRYYDTAEKEVQFPF
GYGLSYTTFEYSDLELSSSNIKDTDDLTVTFKIKNTGDVDGAEIAEIYVADQESTIFRPK
KELRAFKKVFLKAGEEKEVSVTLSKRAFAFYNVELQDWQVETGLFDIMVGASSRDIRLTK
AVNIISDCTAAVPDYRKTAPAYYTADLAAMDDAQWTAVYGKELPARERDTTKPIDLYNCL
DDASHTKWGGKICRLISKVVGKFGSAENGDGQMLAAMATQIPIRNFIAMSMGVFSPKMAE
GLLMILNDDRSTFVGFNKILGGIGGALAKLPKLLKSI

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	29	249	2.9e-59	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.80e-85	66	657	118	758	beta-glucosidase BglX.
COG1472	BglX	8.48e-61	29	337	54	361	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	2.98e-51	317	546	3	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	1.37e-49	30	623	76	742	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	9.85e-31	33	283	64	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGS53344.1	4.03e-264	1	792	1	791
QEN03854.1	1.48e-260	5	789	7	795
AGS53563.1	1.43e-259	1	792	1	792
AEF82048.1	6.12e-258	1	787	1	786
QSX09143.1	3.40e-255	2	789	3	795

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	9.14e-242	6	788	8	753	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.39e-214	7	667	9	666	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.48e-129	5	658	6	707	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	5.27e-128	5	658	6	707	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	9.82e-121	6	664	9	836	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	8.80e-242	6	788	8	753	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.87e-211	7	667	9	675	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	5.29e-211	7	667	9	675	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	6.87e-138	5	659	48	740	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q2U8Y5	5.83e-122	7	656	10	823	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001029_00251.