CAZyme Information: MGYG000001030_01485

Basic Information

• Species: CAG-485 sp900760735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900760735
• CAZyme ID: MGYG000001030_01485
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242		27254.53	8.7561

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001030	3359263	MAG	Sweden	Europe

• Gene Location: Start: 18958; End: 19686 Strand: +

Full Sequence      

MKGIKVSGPWEIVLVVAVCICAFFVNNQVITPDIMESRNIIAAREMVYDGHWITPTMNGD
LRLEKPPLPTWLTAVAEMASPDNVALQRAMAGLAALLLVFYFWRFARKVLDIDPLAPTLL
LVTCYNVILMGRTASWDIYCHAFMMGGIYYLARGLSGKSHQWGNFIASGVFIGLSIMSKG
PVSLYALFLPFLLSYPFFYRHPMRGKTWPLVTMILLALIIGTWWFIYIHLTQTEALEAVA
LK

Enzyme Prediction     

No EC number prediction in MGYG000001030_01485.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	10	232	1.6e-41	0.40555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	3.63e-16	4	228	3	225	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	2.56e-06	65	224	2	158	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS94838.1	1.67e-14	5	225	35	253
QCQ23342.1	2.68e-14	27	234	27	240
AFL72807.1	7.44e-14	3	198	19	212
QOR75910.1	2.42e-13	33	226	31	224
CBX27700.1	3.36e-13	27	218	27	228

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	8.13e-08	11	242	4	234	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998666	0.000149	0.000084	0.000002	0.000001	0.001128

TMHMM  Annotations     

start	end
12	31
84	103
115	134
138	157
170	192
207	229