CAZyme Information: MGYG000001030_02584

Basic Information

• Species: CAG-485 sp900760735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900760735
• CAZyme ID: MGYG000001030_02584
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616	MGYG000001030_31|CGC1	69144.54	4.9624

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001030	3359263	MAG	Sweden	Europe

• Gene Location: Start: 43072; End: 44922 Strand: +

Full Sequence      

MNRGMILGLCSLASAVAVAAPVELTGPGDSHVFENQLCSEVNTAEITIAGRAFDAARDRL
SIYGNGSIVIADGWKEPLTIYSEPNCGGTAKVLERDRYYRGELQGEASFLPEEELGDFDN
RVRSFRLKKGFMCTLANNPDGTGYSRVFIADNEDLTVNAMPEGLDFVSFVRVCRHDWVGK
RGIAGGDVWKLTRSSWFYDWGASAVSDTDCEYVPMRHNRWWDGWDKINSRVDGANMLGFN
EPDHADQSDLGTEVAIDMWPEYMKSGLRVGSPAPDCINKAWLKEFLAKADSLNYRVDFVA
THMYWNSQDPYRLADDIAKLCKNTYGGRPMWITEWNNGANWTNEWWPDAKGPKRDAEFNI
VLDENGKQTEVSRPHTEANSAVQKEWLGKALDAFDKCDWLERHSFYNWVEDARSVEIDGK
LTPAGKVFTEFNSRPAFNSATEYVHTWKIAPPRIMAIKANRTRVRIDFYDHNGETAKGYK
VERRINGGEWKEIAFITPGNGYKMGQTTFFADKDVVGGFMEYRMKAVSYKGTESIWSRVI
GKEVKGSGIEDADMSELTVNARPGGFVIESGEAGELTVYAMDGREVRKVSFTEGTTTVEG
LDKGIYIVDGNKLLVK

Enzyme Prediction     

No EC number prediction in MGYG000001030_02584.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	193	427	3.6e-35	0.9553571428571429

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam11790	Glyco_hydro_cc	1.57e-24	195	428	19	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.
TIGR04183	Por_Secre_tail	2.73e-04	566	616	13	67	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.
pfam01229	Glyco_hydro_39	0.001	239	345	155	281	Glycosyl hydrolases family 39.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUC19783.1	2.70e-128	46	540	427	924
APZ45921.1	2.70e-128	46	540	427	924
AXY72824.1	1.16e-106	59	537	463	904
ASB49856.1	4.71e-102	46	543	109	595
BAV05333.1	9.24e-97	44	540	597	1057

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UAQ_A	1.82e-17	196	335	47	194	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	4.49e-17	196	335	47	194	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]
6UAS_A	1.11e-16	196	333	47	192	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei]
6UAT_A	1.11e-16	196	335	47	194	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei],6UAU_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose and laminaribiose [Amycolatopsis mediterranei]
6UAY_A	1.27e-11	160	334	15	207	Crystalstructure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000340	0.998853	0.000180	0.000212	0.000205	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001030_02584.