CAZyme Information: MGYG000001032_00065

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_G
• CAZyme ID: MGYG000001032_00065
• CAZy Family: GH81
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1271		142993.05	4.799

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001032	1474174	MAG	Sweden	Europe

• Gene Location: Start: 98; End: 3913 Strand: -

Full Sequence      

MDKSGNQIITEDGQAVTVDHFAVETQNESEAPGDGNKKQYHYYGVYMPENSTVTKVGNKL
KIKLGSNQNYLVIGALAVEEPIPLLAGKEETDSISNPESLRDGDAVKQLEYRYKYAYSYV
TDTVVNYSYDEAKGICTTKYETIVSQKRTGAGISNTTLMCMMPHQWKYSNDSYTKVNNQA
LIYTSARGDMRIHEGNSFSYSQEFHGIIPQYTTPSESDSYDTEWMYAYLEQFTDSALKSY
WVADPYWQGKKSHPIAMGILIAEQLGEYETRDKLIDALKKIMQNWLTYGGEEDYPYYMYY
HTSWGAVSGDGGDHGMAINLSDHHFLWAYFIFPAAVLASYDDAFVEDYGEMIELLIRDCM
NPDKDDDMLPFMRNFDVYEGHSWAGGYGDNNSGNNQESASEATFGWAGLYLWGLVTGNEK
YEEAGIWGYTSEVNAIEQYWFNVDKGTENDSHNWAPDYGVNVYGDSNVNSIPYIGMVWGL
GYTNGTYFSGNPCCIMGIHMLPVTPAITYMGYDKDTADRIWTEYEQVQEAYQKKVAAEGN
SDPEGWYHILWPYMSLSDAEGAAERWSQEYQSHLNENGDYVGGVLSTDEMFNSYWYIQNM
CAKGNICTDIWSSNYTSYQVFEKTVNGKTTYSAQVWNPSDETITVNFVNAEGNLGSATVP
KHALVSVDPTKNEDKTKDTEYVPYESRDKVNTVPGVIEAEDYDTNFGCEPTTGEEEGGYI
GWIDDGDSLVYNLEVEEEADYVVEYRVQCTDKNKNSAIRLKTDNDADYILTTNLDNTTTD
WKNVKSEQTIHLKAGSYQMKLLLVDGGFNFNYIKIYKEGTKPPVAPTDDLTMADLSDYPE
ISLTDAQVIDVFSEQGDNTGDKIIDKNYDIRWESLAADPQYLTMDLGRTETIGGIKIYWE
TAASKSYVIETSSDNKTWTTVFTRTNGNGGLKNGDENRSSGLESISLTKVTDARYVRIYS
TERVGGYGVSIWEVRLYGRGADQKEQLDAPNVTAILSSDKITVNWNAVENAEHYIVYRTS
PTATKTKVATVTGTSYEDTSLNVSGKYTYYVVAVPAADSENYVNSAYSQASNSITYNKPE
PSTTEPVEQTTEPITIPDETTTSVTEPQETTKSPDTTNKNEETTTSNQKEESSVIVKNGT
KFKVGKLVYRVKNTKKKTVQVVSTVSKKVKKVSVPKKVTYQKVSYKVVAIGNNAFKNRRK
LTKVTIGANVRTIGKKAFYNCKKLKKVIIKSQKLKKVGKQAFRKVNKKVFVKIPKGMKKK
YKKMLKSVTIK

Enzyme Prediction     

No EC number prediction in MGYG000001032_00065.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	54	574	4.3e-109	0.7572347266881029
CBM32	853	974	5.1e-23	0.8870967741935484

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5498	Acf2	2.59e-60	122	568	290	731	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
pfam17652	Glyco_hydro81C	7.26e-40	269	569	60	332	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
pfam00754	F5_F8_type_C	1.25e-16	853	973	7	125	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd04080	CBM6_cellulase-like	8.24e-16	693	815	1	143	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
sd00036	LRR_3	3.10e-11	1186	1254	1	68	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADQ45030.1	3.85e-281	2	983	501	1373
BCJ99064.1	9.00e-234	2	815	502	1242
AIQ32147.1	1.79e-155	2	980	479	1289
QJC54428.1	2.74e-147	1	978	496	1396
QZN75609.1	3.45e-145	2	672	504	1092

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FOP_A	5.98e-72	104	664	209	711	ChainA, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	5.35e-65	40	647	191	734	ChainA, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]
5T4A_A	8.71e-65	40	647	211	754	ChainA, Glycoside Hydrolase [Halalkalibacterium halodurans C-125],5T4G_A Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]
5UPI_A	1.33e-64	40	647	191	734	ChainA, BH0236 protein [Halalkalibacterium halodurans C-125],5UPM_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPN_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPO_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125]
5T4C_A	2.13e-64	40	647	211	754	ChainA, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9UT45	4.28e-25	2	597	179	731	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
D4AZ24	1.82e-21	246	568	574	878	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
Q12168	8.40e-19	150	592	347	779	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
P53753	5.76e-18	124	558	655	1077	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
Q09850	8.83e-18	246	562	379	672	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001032_00065.