CAZyme Information: MGYG000001033_00034

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; UBA1390
• CAZyme ID: MGYG000001033_00034
• CAZy Family: GH142
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487	MGYG000001033_10|CGC1	57145.93	6.2935

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001033	2187204	MAG	Sweden	Europe

• Gene Location: Start: 24; End: 1487 Strand: +

Full Sequence      

MARVPGVSCSHSMLDRAWVYRWFIMRHCTAYPAFGNLRHAVMYEGRSHRMNKTPFVSKGW
EFSKLIPLSTSLHVTDYRWNEDHETAREFLRSFFDSADENGIPRSTVTNDYLAAYANYGV
WAVYQLYLVDGDKAFLEEVLPAMKAYIQGHIKVHGDPEDALQIEYTHSRTGKEYQPSYWY
FHNYPMNPKDKSTYTPLKRVDRSVYHYLNTKGLAAICRGLGDPDQKTYEELAKRIAGDIN
RKMWDEETHFYYDLHYQTDEKAMVKNIVGFYPYWAEITNDEKLPGLIYLMDPEQFDTGNA
FPSVSKENPVYSPDGGWQGNFIKGRNGCVWDGPSWPYTTAIALSALGKQSQKHEHRYDRD
FWRFFRQYTNQHFRDGDVERPYLVEHYNPESGERLSDEVDYNHSYWIDLVVTFVAGVDVE
EDRIIVDPLRLGLKWFRLDNLRIRGHRYTVSWSEGKDRAEAPKGFRILRDGEKIYEGDTL
ERVEIEG

Enzyme Prediction     

No EC number prediction in MGYG000001033_00034.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH142	2	482	6e-58	0.9478079331941545

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	4.24e-14	200	319	578	709	alpha-glucosidase; Provisional
pfam17389	Bac_rhamnosid6H	2.48e-06	83	253	62	223	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	1.04e-04	84	365	303	562	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFH63258.2	5.16e-180	5	485	221	707
AFC30936.1	6.41e-180	5	485	228	714
QNK60812.1	5.81e-175	3	484	217	699
QQR38309.1	3.33e-153	4	453	220	670
CCW34533.1	1.80e-49	8	474	397	864

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	3.34e-07	200	319	551	682	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7W_A	3.34e-07	200	319	551	682	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7X_A	3.34e-07	200	319	551	682	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	3.53e-07	200	319	100	231	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]
7PQQ_B	3.53e-07	200	319	100	231	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	7.57e-11	121	315	119	296	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
P42592	1.85e-06	200	319	574	705	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000022	0.000036	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001033_00034.