CAZyme Information: MGYG000001034_00877

Basic Information

• Species: Prevotella sp900554695
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900554695
• CAZyme ID: MGYG000001034_00877
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465		53165.8	6.4198

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001034	3004037	MAG	Sweden	Europe

• Gene Location: Start: 9513; End: 10910 Strand: +

Full Sequence      

MTRKSLFIALLMVLSVVSASAQQKSLHQLQQDFVDLRFGMFIHFNIPTFAPDDWPDPDLP
ASVFNPKKLDCTQWAKAAKSANMSYGCLTTKHHSGFCIWDTKTTDYNVMNSPLKRDVVRE
YVDAFRKAGLKVMLYYSILDTHHRIRPHMITREKIDMIKAQLKELLTNYGPITALIIDGW
DAPWSRISYDDVPFPEIYNYIKSLQPECLVMDLNAAKYPREALFYTDIKSYEQGAGQKIS
TSENQLPALACLPLQKNWFWKESFPTDKMKPAEEMINDNVIPYNKAYCNFILNVAPNRDG
LMDDNALEELRKMGKMWKNDGRVAELPECDAPITEQNIAKNKPSESSWSYDYGIMDFAND
DDFVSAWTSNPRVETPWWSVELGDGKTIDMVTITEEEGGVMKEYTLEYRSGGTWKTLFSG
KAKTQSLVKIHRFAPVKADAVRVTVTRHDGTVKIAELGVYTPYTK

Enzyme Prediction     

No EC number prediction in MGYG000001034_00877.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	22	321	3.1e-75	0.8872832369942196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	7.07e-48	27	315	17	328	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	9.91e-48	27	317	16	327	Alpha-L-fucosidase.
COG3669	AfuC	2.60e-26	28	314	13	309	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam00754	F5_F8_type_C	2.36e-11	344	455	4	122	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
smart00231	FA58C	0.001	328	446	1	124	Coagulation factor 5/8 C-terminal domain, discoidin domain. Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ40132.1	1.17e-242	4	460	2	459
QQA10757.1	1.17e-242	4	460	2	459
QMW89201.1	1.17e-242	4	460	2	459
AAO79061.1	1.17e-242	4	460	2	459
BCA48501.1	1.21e-242	4	460	3	460

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GN6_A	5.26e-41	37	321	38	348	Alpha-L-fucosidaseisoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_B Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_C Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_D Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_E Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_F Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus]
5K9H_A	9.00e-32	35	210	48	233	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
3EYP_A	2.30e-30	41	460	25	454	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
3UES_A	1.63e-27	41	445	34	461	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	1.37e-26	41	445	34	461	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	2.13e-30	39	316	51	339	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	4.10e-26	39	461	53	477	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q5RFI5	3.04e-14	28	323	43	364	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1
Q6AYS4	9.38e-14	33	323	42	358	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1
Q9BTY2	1.28e-13	28	323	45	366	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000224	0.999198	0.000147	0.000159	0.000143	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001034_00877.