CAZyme Information: MGYG000001034_01387

Basic Information

• Species: Prevotella sp900554695
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900554695
• CAZyme ID: MGYG000001034_01387
• CAZy Family: CBM66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
978		109219.53	4.3702

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001034	3004037	MAG	Sweden	Europe

• Gene Location: Start: 5296; End: 8232 Strand: +

Full Sequence      

MRKGFITLFSLVVPLTLSAQSRITVDAAKVEGTIPQLIYGAGAEDVNHEIYGGLYDQRIF
GESFEEPAFTQISGFASYDNQWSLEGDVLRLDTDGFGKIVYNGRKLSKATVEVDMRIDGA
DAIAGFIFNVSGAANGADAFNGYEISLDAGDRKLVVGKHENNWQPITEVPVEFSPAEWNR
LRVDFDGAKVSIFINDEKIYDYQDTANPLTEGYVGLRSYDGSASFRNLKIDGSQITFGAL
PADVDNFRRYDDYWIVEDDVMRTSTQGFAKAVYQGGEMQEGSVSADVRMDGARSISGFII
DVSDAGNGADAFRGYEISLDADDHKVVVGKHDHDWQPIADIPASFNSSEWNSLRVDFSGA
TFTVFLNGTSVYEYTDDSNPLMKGKVGLRTFDGPASFRDFRIDGETVALRNTPVGVSSMW
TPVGSGVYEHDGTQAFNGTYSQKITGAAGDGICNFGLNKWGIGIVEAAPMSGYVYLKGNV
DNAYVALQSADGSREYCRSEIGGIGQDWQRFDFEMTPSASDNNARFVVALDGEGTMWVDM
AMLHTSSFPYRADLTQNFMNEKLTFLRYGGTMINAPEYKVKNMIGPRDQRPPYKGHWYRY
STNGFGIIEFVAFARKIGTEPTFSINIEDDPQDVIALLEELEPYDLKYIEIGNEENIGDE
SLSAYEHYVERFLAFYNAIHPLYPELQFINAAWWRQDKPELMKYVFNSLDGKAALWDYHP
WTDEIDQARAVETELKNMRQMFLDWNPQTSMKCAILEENGNTHNMHRALSHAVVLNAVRK
MNGFVQLDSPANALQPYLQNDNGWDQGQIFFNSSMSWCQPPYYAQQMAASHHQPLLINSV
SSNRNINMTATRSEDGRTVVLHIVNTSSNDISVDIDIKNAGNISNIRRVSLCGDLADINT
PYEPEKIIPQETELQNMQMTLEAKSYTVLEVSCDVLDNIGNVTLDESQESVYYNISGQRV
VDPQHGIYINNNGQKVIM

Enzyme Prediction     

No EC number prediction in MGYG000001034_01387.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	550	933	7.4e-42	0.6507936507936508
CBM66	72	227	1.8e-29	0.9741935483870968
CBM66	247	399	1.2e-23	0.9548387096774194

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3534	AbfA	4.17e-18	562	934	62	501	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].
smart00813	Alpha-L-AF_C	2.47e-17	745	925	3	189	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
pfam06439	DUF1080	3.28e-13	88	230	33	181	Domain of Unknown Function (DUF1080). This family has structural similarity to an endo-1,3-1,4-beta glucanase belonging to glycoside hydrolase family 16. However, the structure surrounding the active site differs from that of the endo-1,3-1,4-beta glucanase.
pfam06964	Alpha-L-AF_C	2.02e-11	816	925	67	192	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
pfam06439	DUF1080	2.33e-11	254	402	25	181	Domain of Unknown Function (DUF1080). This family has structural similarity to an endo-1,3-1,4-beta glucanase belonging to glycoside hydrolase family 16. However, the structure surrounding the active site differs from that of the endo-1,3-1,4-beta glucanase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL02085.1	2.48e-201	18	914	25	789
BBL12837.1	1.54e-199	18	914	25	789
BBL10044.1	1.54e-199	18	914	25	789
CUA16970.1	4.77e-188	16	929	15	795
AKA54044.1	9.49e-188	16	929	15	795

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	2.41e-08	499	928	147	619	ChainAAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9SG80	5.56e-25	447	950	138	670	Alpha-L-arabinofuranosidase 1 OS=Arabidopsis thaliana OX=3702 GN=ASD1 PE=1 SV=1
Q8VZR2	8.38e-23	449	942	139	659	Alpha-L-arabinofuranosidase 2 OS=Arabidopsis thaliana OX=3702 GN=ASD2 PE=2 SV=1
U6A629	5.89e-20	441	692	97	391	Alpha-L-arabinofuranosidase A OS=Penicillium canescens OX=5083 GN=abfA PE=1 SV=1
Q0CTV2	2.44e-16	420	929	78	625	Probable alpha-L-arabinofuranosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=abfA PE=3 SV=1
B8NKA3	7.37e-13	460	884	122	582	Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=abfA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000452	0.998589	0.000403	0.000192	0.000184	0.000160

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001034_01387.