CAZyme Information: MGYG000001034_01889

Basic Information

• Species: Prevotella sp900554695
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900554695
• CAZyme ID: MGYG000001034_01889
• CAZy Family: GH16
• CAZyme Description: Keratan-sulfate endo-1,4-beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
266		30291.14	6.9613

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001034	3004037	MAG	Sweden	Europe

• Gene Location: Start: 36531; End: 37331 Strand: -

Full Sequence      

MNKGTRLIIAAAILAATVCSCGVTRGTVSDGWTLVWEDNFDRKHSFDTATWSRIDRGTSD
WNRHMSHHDACYAMRKGNLVLRGIINDVAPNDTAPFITGGVCTMGKRTFSDGRLEIRARL
NAAQGAWPAIWLLPENGSWPRDGEIDIMERLNGDSIAHQTVHSHYTYDLGIKDNPPSHAT
GPIDPDAYNVYAVEMYRDSLAFFINDRHTFTYRRIETDKEGQFPFDRPFYLLIDMQLGGS
WVGAVRRNDLPVEMLVDYVRFYKRRQ

Enzyme Prediction     

No EC number prediction in MGYG000001034_01889.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	36	262	4.1e-54	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	2.00e-74	36	262	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	5.48e-25	38	262	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02182	GH16_Strep_laminarinase_like	1.61e-24	31	262	1	258	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd08024	GH16_CCF	1.50e-20	38	263	59	330	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
COG2273	BglS	2.34e-13	32	262	41	263	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA09179.1	1.59e-132	7	265	8	265
QUT40553.1	6.46e-132	7	265	8	265
ALJ43937.1	1.30e-131	7	265	8	265
QUT72755.1	1.30e-131	7	265	8	265
AAO77657.1	6.14e-130	7	265	8	265

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	3.76e-98	32	263	29	262	ChainAAA, Beta-glycosidase [Bacteroides caccae]
3ILN_A	5.22e-32	32	263	5	248	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]
4CRQ_A	6.66e-32	32	264	3	232	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
6JH5_A	5.21e-29	32	264	4	233	Structureof Marine bacterial laminarinase [Aquimarina]
6JHJ_A	3.92e-28	32	264	4	233	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	8.26e-51	32	263	56	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	2.85e-33	12	263	17	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	2.36e-25	23	263	410	680	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
Q8N0N3	1.47e-12	95	240	130	303	Beta-1,3-glucan-binding protein OS=Penaeus monodon OX=6687 PE=2 SV=1
O33680	6.27e-12	96	262	303	457	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000169	0.081153	0.918594	0.000032	0.000043	0.000037

TMHMM  Annotations     

start	end
7	29