CAZyme Information: MGYG000001036_00956

Basic Information

• Species: CAG-1031 sp900752535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-1031; CAG-1031 sp900752535
• CAZyme ID: MGYG000001036_00956
• CAZy Family: GH65
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
676		75513.49	5.2516

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001036	3018511	MAG	Sweden	Europe

• Gene Location: Start: 413; End: 2443 Strand: +

Full Sequence      

MSVKNLIAAAALWLQATTLWASVDKTDEWHIVADDFSNYNGVTLANGTIGIQTSDKLLEV
GDVVLNNVYMSRRPGDVSRIARGPQFLNLVIDIDGKTLTDSNVSHKRQVLDMKEAKMKMI
FDADGAEISYEIMAMRNLPYMGLVRVRVKAKRDINIDVRNRTSFATEYVDCSADFKNLRD
GSHTMPLMVSRAISYDRSVAVASATAFLFPTEEHPEIVSEDVVDGYPAMKFVTDLKKGQT
LEFSLMGAVTNSIEFPNLDADVERMAVYALRSDPDTLVDGHKKEWERLWESDIIIEGDAE
SQRDVRLALYHLYSFGGEGTRNSIAPMGLSTVTGYNGHVFWDTEMWMYPPLLMLNQDMAR
SCIDYRTDRLPQACRRARHYGFGGAMYPWESDCSGEEATPTWCLTGTFEHHISADIAIAF
WNYYRVTRDVDWLRSEGYEVMKNVADFWKSRATLNTDGSYSIKNVVGANEYAANIDDNAF
TNGAAKRALEYTVKAADVVGVAPDPKWKKIADGLKFYQMSDGTTMEHSKYAGEIVKQADV
NLLAYPLEIVTDRNRILADVEYYAKKIDGNGPAMGNSILAILYSQSGDADKAYEFFHKAF
VPNKRPPFGVLSESANSNNPYFCTGAGGLIQVVLSGFAGLRFTDNGIEQTYTCLPKGWKS
LTIKGVGPEKKTYVIR

Enzyme Prediction     

No EC number prediction in MGYG000001036_00956.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	306	644	1.2e-99	0.9946236559139785

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	6.24e-103	25	661	7	718	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	1.51e-65	306	647	1	387	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
PRK13807	PRK13807	5.29e-48	83	512	84	537	maltose phosphorylase; Provisional
pfam03636	Glyco_hydro_65N	9.65e-08	84	243	69	231	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDS46993.1	1.98e-232	22	675	16	676
SDB50400.1	2.80e-232	25	675	19	676
AWX45602.1	1.13e-231	25	676	21	678
QDO94572.1	2.27e-231	25	675	19	676
AXT56849.1	1.15e-227	25	675	26	682

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	2.48e-181	27	675	22	676	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	7.53e-44	231	661	230	714	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
1H54_A	2.66e-35	74	666	75	714	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
4KTP_A	5.86e-28	188	666	187	714	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	1.37e-27	188	666	187	714	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54KX5	1.41e-71	275	675	252	659	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Dictyostelium discoideum OX=44689 GN=pgghg PE=3 SV=2
A0JMP0	9.80e-56	281	666	186	585	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Danio rerio OX=7955 GN=pgghg PE=2 SV=1
Q32M88	8.05e-50	277	666	227	627	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Homo sapiens OX=9606 GN=PGGHG PE=1 SV=2
Q8BP56	7.79e-49	281	653	230	614	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Mus musculus OX=10090 GN=Pgghg PE=1 SV=1
M1RNJ8	2.47e-47	87	643	268	864	Periplasmic/secreted acid trehalase ATH1 OS=Candida glabrata OX=5478 GN=ATH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000289	0.999106	0.000162	0.000155	0.000144	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001036_00956.