CAZyme Information: MGYG000001036_01248

Basic Information

• Species: CAG-1031 sp900752535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-1031; CAG-1031 sp900752535
• CAZyme ID: MGYG000001036_01248
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000001036_228|CGC1	42005.52	9.3101

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001036	3018511	MAG	Sweden	Europe

• Gene Location: Start: 6874; End: 8001 Strand: -

Full Sequence      

MRYFISPGEPSGDLHASQLIVSLREQDPAADFTFLGGDRMAEEAGTSPLLHYRDMAFMGF
SEVLRHLPRIFSNLATARQALEQKRPDALILVDYPDFNLKLARTAAGLGIPVYYYIPPKV
WAWKEYRVKDLRRLCRRIFAIFPFEKVFYARHSMSDMVEYVGNPSVEEFDGQLGRTMAYE
EFRTFHDLTTRPMLALVPGSRHGEVRNNLPVMAAVARHYRQLQGVVAAAPGIEMEFYRRY
TTLPVVRGVTPDLMVHARAALVTSGTATLECALAGTPQVVCYRANGSRLSYTLMKRLLKV
SHVSLPNLIAGRTIIPEMLLHHCNPAEVTAALDNILDGKPGHDAQLKGYADMRARLGESR
ASERAAARIVADLSR

Enzyme Prediction     

No EC number prediction in MGYG000001036_01248.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	356	1.7e-106	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.34e-112	1	373	2	374	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.76e-104	1	375	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	6.21e-78	4	369	2	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	9.77e-72	1	371	1	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.11e-49	1	319	2	300	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36425.1	2.06e-148	1	374	1	375
QQR08529.1	5.71e-147	1	366	1	367
ASB37800.1	5.71e-147	1	366	1	367
ANU64105.1	5.71e-147	1	366	1	367
QCP71596.1	4.35e-125	1	356	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.80e-45	8	342	14	352	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.80e-45	8	342	14	352	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	6.47e-73	2	366	6	371	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
C1F718	5.22e-66	4	356	8	371	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1
Q2LVL8	1.11e-63	5	366	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q2IL69	1.57e-63	2	370	10	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B4UHR6	3.11e-63	2	370	10	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001036_01248.