CAZyme Information: MGYG000001037_00132

Basic Information

• Species: DTU089 sp002440045
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; DTU089; DTU089 sp002440045
• CAZyme ID: MGYG000001037_00132
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457		52223.61	8.5507

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001037	1935424	MAG	Denmark	Europe

• Gene Location: Start: 4680; End: 6053 Strand: -

Full Sequence      

MKLYIDSGKTYQTFEGFGASGAWWAQEVGSWENTDEKSGIPVRDEISRLLFDKTYGIGLK
TYRYNIGGGSKHSRKGYFSEPLRMTECFETAPGEYDWSRDAAAVYMMKSAVKNGADEVIF
FVNSPIERLTQNGKTHLDKFPPFKENLKSKNYAAFAKYCLDVTEHFLNDGVPIKYVSPVN
EPFWVWNGGQEGCHYRPKSCRKLFRVFVSEMDKRPNLKNVMLSGCENGDIRWFNKSYTRS
VLSDPYIRTRLRGIDVHSYCLKMPIPFFNNRLAFLKRFAKYMKKKYPGVPVVMSEWTHMQ
GGRDSTMNSALVAASVIYEDLSIINAVSWQHWIAVSEVNYCDGLIYINLDSKTYEITKRY
YVTGNFSKYIPEGAKRVEAHTVGGSLKTLAFIKDNECVSIVINESENRETLEIPKEYVGE
KYIVTDESESLIEHTLNGAVVEISPKSVTTLILKKLS

Enzyme Prediction     

No EC number prediction in MGYG000001037_00132.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	2	452	3.5e-101	0.9958677685950413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	7.39e-57	2	346	3	367	O-Glycosyl hydrolase family 30.
COG5520	XynC	1.18e-08	134	405	130	372	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ93176.1	1.31e-120	1	455	58	515
BCJ99845.1	8.08e-120	3	455	62	518
AUJ86440.1	4.40e-110	3	451	44	488
AZP04141.1	8.32e-108	5	451	47	489
BBC60194.1	1.39e-107	1	452	45	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	1.39e-27	5	425	10	468	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
7O0E_A	1.06e-09	3	453	5	447	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	6.13e-09	3	453	12	454	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6M5Z_A	7.73e-09	3	453	25	453	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
5CXP_A	1.54e-08	144	404	104	329	X-raycrystallographic protein structure of the glycoside hydrolase family 30 subfamily 8 xylanase, Xyn30A, from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q76FP5	9.43e-18	3	373	24	381	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1
G2Q1N4	1.13e-09	3	453	29	471	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001037_00132.