CAZyme Information: MGYG000001037_00198

Basic Information

• Species: DTU089 sp002440045
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; DTU089; DTU089 sp002440045
• CAZyme ID: MGYG000001037_00198
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420	MGYG000001037_29|CGC1	47118.6	5.1261

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001037	1935424	MAG	Denmark	Europe

• Gene Location: Start: 175; End: 1437 Strand: +

Full Sequence      

MKKGVDIGFIGISGRGSSMLDLLLQVEGVRVPAVCDKVVERAENGIEIVNKRTGNAYPVH
AYIDYKELLKNEKLDAVMICTTWITHTRIAIDAMRAGCNVAFEVGGAASIEECWQLVRTS
EDTGKFCMLLENCCYDRNEMALFNMIKMGLFGEITHMEGGYRHDLREEICMGRENIHGRL
FNFMHRNGELYPTHQLGPISKALGINRGNRFLTLVSMSSKSRGLNEWIKSRKGEDYDIAN
YAFNQGDVTTTIIKCANGETITLTHDCSTPRPYSRNYVIEGTKGIYSENNGECGGLYLDS
FSDGEPRWREFKDYREKYEHPLWQAYEKGGIKAGHGGMDYLVLSAFVESLLLEAKPPIDV
YDTASWMAITCLSEQSAAMGGMPVPVPDFTNGMWIDREPYRKGTYCLEEVCAFGSGDDCE

Enzyme Prediction     

No EC number prediction in MGYG000001037_00198.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	4	395	2.5e-147	0.9824561403508771

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.44e-20	1	388	1	342	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	2.27e-09	7	128	3	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM67823.1	1.20e-159	5	412	3	410
AEE95391.1	1.40e-155	5	410	9	408
QTH41090.1	2.14e-145	3	405	8	404
ANY74959.1	2.65e-144	3	398	10	399
AEF80535.1	1.02e-141	3	410	7	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	3.27e-102	3	409	19	442	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	9.85e-79	5	399	43	443	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3E18_A	1.18e-08	3	158	4	150	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	1.79e-101	3	409	19	442	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
A6LB54	1.10e-99	8	399	53	462	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8G1	2.32e-99	8	399	56	464	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
Q01S58	4.78e-97	5	399	43	437	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1
B2FLK4	7.64e-94	3	399	32	446	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001037_00198.