CAZyme Information: MGYG000001037_00605

Basic Information

• Species: DTU089 sp002440045
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; DTU089; DTU089 sp002440045
• CAZyme ID: MGYG000001037_00605
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479		54867.12	5.2835

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001037	1935424	MAG	Denmark	Europe

• Gene Location: Start: 14872; End: 16311 Strand: -

Full Sequence      

MERKSGVLMHISSLYGDYSSGGFGKSAFSFIDFLKDCGFSYWQVLPFNPVDECNSPYKSA
STFALNPYFADIDSLFEQGLITEEERRASVQKTPYYCEYDRLKKERLALLKKAASRADGD
LSKSVEDFIKARPYIRDYCEFAALKEVNGEKPWTEWTEVSFDKDEFFAQCFIQYELFYQW
QKIKSYANKNGIKIIGDIPIYVSFDSADVYFNKELFCADENGRLSLVAGVPPDYFSADGQ
LWGNPLYNWEKMEKDGFSWWRERLNNALSLFDGVRIDHFRGFESFWAVPASEKTAKNGSW
KKGPGMKLINVLKKTAGEKLIIAEDLGDITEDVIKLVNDSGFPGMRVFQFGFLGGESLHK
PHNYINNCVAYSGTHDNNTLLGYLWEMPLDTKRDVMNYCSCDPEKWNENGCRAIVKTILA
SSAGLVIFPIQDLLGYGSDTRLNVPGRAYGNWLYRITKEQLGFINKDELRYYNALYGRI

Enzyme Prediction     

No EC number prediction in MGYG000001037_00605.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	9	469	2.3e-143	0.97165991902834

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	0.0	1	479	3	497	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	0.0	9	457	1	458	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	6.88e-150	1	456	26	500	disproportionating enzyme
COG1640	MalQ	1.30e-141	1	479	12	515	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
TIGR00217	malQ	1.61e-120	2	478	13	513	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT73240.1	1.62e-162	2	479	4	506
ADO38582.1	4.89e-159	2	479	4	506
ARD65542.1	4.89e-159	2	479	4	506
AWW25287.1	2.24e-149	3	478	6	506
ALU15685.1	1.72e-147	38	479	2	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TZ7_A	6.14e-123	3	478	22	503	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
5CPQ_A	2.58e-116	3	479	70	564	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
1X1N_A	4.45e-116	3	479	26	524	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
7COV_A	2.05e-115	3	479	78	576	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]
6M6T_A	8.44e-115	2	478	4	496	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A3Q1	6.60e-125	2	479	3	496	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
P0A3Q0	6.60e-125	2	479	3	496	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
P72785	1.87e-124	2	478	4	499	4-alpha-glucanotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=malQ PE=3 SV=1
O66937	4.51e-123	3	478	2	483	4-alpha-glucanotransferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=malQ PE=1 SV=1
Q59266	1.38e-119	9	478	1	485	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001037_00605.