CAZyme Information: MGYG000001037_01666

Basic Information

• Species: DTU089 sp002440045
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; DTU089; DTU089 sp002440045
• CAZyme ID: MGYG000001037_01666
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
765		87635.32	5.8749

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001037	1935424	MAG	Denmark	Europe

• Gene Location: Start: 19299; End: 21596 Strand: +

Full Sequence      

MQNVRYIIKNIDENTFSSSFVLIDEVMGSAVIKKTDEKTFEVSNIFIKEEYRRFKHGSKI
LSAAFSEVKKLGGETLFAEAPAELLPFFEKNGFEKCGVTYKKDGARYIKVEKSFVFDGCM
WLSFNKELEAAIVKKSFNYTHTHDKNRVYLTVSALGFSEIFVNGKSVSDRLFAPAWSNYN
ARDLSVLCYPIFDTLTYRVYYERFDITDLLVDGKNTVVFHIGGGWYCQHESRNEGINKYG
FLKLCFKITQDGEIIAKSDGDTLFTKSFITRANIYFGETQDLRRGNYDFSTEPTFGEWKK
CDEDAAPLSLFRLSNYPEDRVVRKLYPKCIFRRGDYAIYDIGENVAGFPVIRFKDGAALD
ERCLLRFAEELKSDGSLDFHYSGGRGRMQCEEYIYDGSCKAALHQHFTWHGARYFEVLGE
AEVLEYCVAHTDIKKIISFKSSEPVLQWIFDAFIRTQLDNIHCSVPSDCPHRERLGYTGD
GQLASRAVMTCFDAEALYRKWLDDIADSQDIFSGHVEHTAPFYGGGGGPGGWGGAMVFVP
YNFYEFYGDKTVLEKYYPNMLLYLDYMESHSENSLVVRGEKGGWCLGDWCAPHNKNRLPE
PFVNTYFYIRALMCVIEISKILKKDSSVLQERAERIKKAFLEKYFDEKSGTFFGSVEAAD
AFGFDLGLGNEKTLENIVEKYEKLGEFDTGIFGTYVLIKTLCENGEKKLAKKLLTSNGEN
SFYNMMKHGATTLWENWDGCDSRNHPMFGAVTEFIVKYFNEVTNY

Enzyme Prediction     

No EC number prediction in MGYG000001037_01666.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	335	758	2.5e-105	0.8571428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	9.08e-79	438	758	5	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.33e-26	147	323	7	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	5.47e-09	338	419	9	86	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam13508	Acetyltransf_7	3.37e-06	24	95	12	83	Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.
pfam13673	Acetyltransf_10	7.74e-06	42	114	54	128	Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97255.1	4.08e-181	129	755	15	638
BCJ98018.1	2.22e-135	119	758	125	791
QOY86540.1	1.98e-103	117	750	149	767
QUT50058.1	8.76e-102	130	757	161	790
QBE96295.1	1.82e-96	121	763	126	769

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.44e-59	130	757	176	832	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.69e-46	146	755	317	926	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.01e-40	134	754	135	759	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	6.54e-52	130	757	184	838	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	1.44e-45	146	755	317	926	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	4.80e-44	133	757	177	812	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	4.80e-40	150	757	188	812	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KM26	7.61e-11	413	751	701	1063	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001037_01666.