CAZyme Information: MGYG000001039_00270

Basic Information

• Species: Phocaeicola sp900553185
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900553185
• CAZyme ID: MGYG000001039_00270
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
783		86757.11	5.2244

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001039	3066315	MAG	Denmark	Europe

• Gene Location: Start: 20070; End: 22421 Strand: -

Full Sequence      

MKQIKNLALASVLCAGSYVAGVAQQVAPAIPADPAVEQNIRNWLKKMTLEEKIGQMCEIT
VDVVTDFPGSKDGFKLSEAMLDTVIGKYKVGSILNVPLSVAQKKEVWAKAIKQIQEKSMK
EIGIPCIYGVDQIHGTTYTLDGTLFPQGVNMGAAFNRELTRRGAEISAYETKAGCIPWTY
APVVDLGRDPRWPRMWENYGEDCYVNAEMGVAAIQGFQGTDPNHIGPNHVAACVKHYMGY
GVPVSGKDRTPSAISRTDLREKHFAPFLAAIRAGALSLMVNSAVDNGMPFHANKELLTDW
LKHDLNWDGMIVTDWADINNLCTRDHIAATKKEAIKIAINAGIDMSMVPYEVSFCDYLKE
LVEEGEVPMSRIDDAVARVLRLKYRLGLFEKPDWDIKSYDKFGSAEFAADALQAAEESEV
LLKNEENILPLAMGKKILLAGPNANSMRCLNGGWSYSWQGHRADEFAQAYHTIYEALCNK
YGKENIIYEPGVTYAPYKNDNWWEENTPEIEKSVMAAAQADVIIACVGENSYCETPGNMN
DLTMSVNQRNLVKALAATGKPVILVLNQGRPRIINDIEPLAKAVINVMLPGNYGGDALAN
LLAGDANFSAKMPFTYPKYINSLATYDYKPCENIGQMGGNYNYDAVMDVQWPFGFGLSYT
TYHYGNLKVDKSQFTADDELTFTVDVTNTGKVAGKESVLLFSKDMVASSTPDNIRLRNFE
KIELRPGETKTVTLKLKGSDLAFVGYDGKWRLEQGDFKIKCGDQWIDLQCTATKIWDTPN
KIL

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	119	348	1.8e-63	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.28e-145	1	762	1	751	beta-glucosidase BglX.
COG1472	BglX	1.19e-77	47	464	1	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	4.32e-71	48	382	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	4.68e-52	143	763	112	770	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	2.11e-48	420	659	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM99675.1	0.0	1	781	1	781
ADY35485.1	0.0	1	781	1	782
ADY36471.1	0.0	1	781	1	782
QUT79256.1	0.0	1	781	1	781
QDM10337.1	0.0	1	781	1	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	0.0	24	781	1	759	Bacteroidesovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5XXL_A	2.19e-106	44	762	18	738	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.17e-105	44	762	18	738	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	3.93e-103	45	762	18	737	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	1.69e-96	37	762	4	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXU3	0.0	1	781	1	781	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
Q23892	2.99e-152	40	768	80	818	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
Q56078	3.70e-105	40	762	38	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	2.87e-103	120	762	61	707	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	2.14e-102	44	762	42	751	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.041875	0.951035	0.006019	0.000386	0.000314	0.000338

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001039_00270.