CAZyme Information: MGYG000001039_01273

Basic Information

• Species: Phocaeicola sp900553185
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900553185
• CAZyme ID: MGYG000001039_01273
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		37280.65	8.1216

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001039	3066315	MAG	Denmark	Europe

• Gene Location: Start: 47756; End: 48736 Strand: +

Full Sequence      

MANYHLSFFKKSLLLVVGAVFLMSFIPPQTIRSTESHSDQDTSTEYSCIDIPASIDFCGT
TIDLTRFDRRERMDRELLAFRYMHSTSLQILKRANRYFPIIEPLLQANGIPDDFKYLMVI
ESNINPQAKSPAGAAGLWQLMPGTARDFGLEVGHHIDERYHVEKSTEAACKYLKQAYKRF
KNWESVAASYNAGQGRISQQLEKQYADNALDLQLVEETARYTYRILAAKLLLSDPQKFGF
YLKASDLYPPIPYHTVTISETIDDLPRFAKSQGISYALLRSLNPWIRSTSLPCHGNKEYI
IRIPDKEGMSYNPKVIIPHNPNWVVP

Enzyme Prediction     

No EC number prediction in MGYG000001039_01273.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	97	228	3e-25	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.59e-62	105	229	1	128	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	3.30e-29	100	206	1	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	2.44e-23	70	292	81	302	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	2.91e-23	117	228	7	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	1.97e-19	121	208	22	112	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24006.1	1.13e-165	22	324	15	320
ADY36030.1	1.40e-157	7	326	7	324
QUT56374.1	5.97e-142	42	325	48	331
QEW35083.1	3.43e-141	42	325	48	331
QQY44628.1	3.43e-141	42	325	48	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	1.28e-06	116	197	470	559	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	1.70e-06	116	197	470	559	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
6FBT_A	2.99e-06	121	236	474	600	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	3.05e-06	121	236	503	629	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
5MPQ_A	6.86e-06	71	222	400	539	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	3.68e-22	70	306	78	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	3.68e-22	70	306	78	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	1.43e-11	93	197	21	126	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
O31608	2.48e-07	91	197	64	156	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	2.29e-06	116	197	497	586	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.217567	0.769238	0.009508	0.001880	0.000808	0.000980

TMHMM  Annotations     

start	end
12	31