CAZyme Information: MGYG000001039_02315

Basic Information

• Species: Phocaeicola sp900553185
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900553185
• CAZyme ID: MGYG000001039_02315
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600		68457.72	9.2989

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001039	3066315	MAG	Denmark	Europe

• Gene Location: Start: 18566; End: 20368 Strand: -

Full Sequence      

MKFIHTICLSLILSASSFHTGIFAQASNDYFLHTVSKGQSLYSIANMYDTTVDEIVRLNP
GSDTQINAGQALKIPQKNARTGSSQEKSFHTIQAGETLYQLTVKYNVSAKAICAANPGLS
ASNFKIGQVIVIPATDTTTSTATQKSDSPTTPATTTSKRDWKEMHKVEKKETIFSISKEY
GITQEELIAANPELRTKKLRKGMFLFIPYPKSSEKKETPATPTIIPTNEELFSESRFERK
NISTIKVAVLLPFMTGTDNREEQQRMTEYYEGFLLAVKELKSQNVSIDLYTYDTKGNTAT
LNSILNKAELRNMDLIIGGVRSANIKLLADYAAKNDIRLVIPFANKVDQVFNNPNIYQVN
TPQSYLYSEVYEHFTRTFKKTNVIFLDTQNGDKEKNEFISGLKRELKDNRITFKQTAIDP
QTTPEKMIASMDTLSENVFVPISGKSSALAQAFPTLLQIRRSHPNFRMHLFGYPEWQTYT
QEYLSNFYELDTYFYSSFYTNNLFPAAVQFSKNYRNWYGKEMANSFPKYGMLGFDTGYFF
LKGLAQQGNKLEDNLDRINVTPIQTGFKFERVNNWGGFINRKVFFVHFTKDYELIKMDFE

Enzyme Prediction     

No EC number prediction in MGYG000001039_02315.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	1.17e-10	33	74	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	1.99e-10	33	75	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd00118	LysM	1.54e-09	89	132	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	3.17e-09	33	74	2	44	Lysin motif.
cd06339	PBP1_YraM_LppC_lipoprotein-like	1.20e-08	246	358	1	103	periplasmic binding component of lipoprotein LppC, an immunodominant antigen. This subgroup includes periplasmic binding component of lipoprotein LppC, an immunodominant antigen, whose molecular function is not characterized. Members of this subgroup are predicted to be involved in transport of lipid compounds, and they are sequence similar to the family of ABC-type hydrophobic amino acid transporters (HAAT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO25583.1	3.01e-281	1	600	1	601
QJR68229.1	1.42e-260	1	600	1	602
QJR60047.1	1.42e-260	1	600	1	602
AII69224.1	1.42e-260	1	600	1	602
QJR72564.1	1.42e-260	1	600	1	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UZ2_A	9.78e-06	33	77	5	49	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2G0D4	1.93e-08	15	116	14	117	Probable autolysin SsaALP OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_00671 PE=1 SV=1
O05495	1.09e-07	31	133	2	93	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
Q5HRU2	1.72e-06	33	191	29	175	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q8CMN2	1.72e-06	33	191	29	175	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000241	0.999069	0.000222	0.000163	0.000147	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001039_02315.