CAZyme Information: MGYG000001039_02521

Basic Information

• Species: Phocaeicola sp900553185
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900553185
• CAZyme ID: MGYG000001039_02521
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274		31626.87	4.7613

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001039	3066315	MAG	Denmark	Europe

• Gene Location: Start: 49259; End: 50083 Strand: +

Full Sequence      

MSAKKVLFITQEITPYVPESELATVGQDLPQAIQEKGREIRTFMPKWGNVNERRNQLHEV
IRLSGMNLIIDDTDHPLIIKVASIQAARRQVYFIDNDDYFQHRLMVADENGNEYEDNGER
AIFYARGVLETVKKLRWCPDIIHCHGWMSAMVPLYIKKVYYDEPSFRDSKVIFSVYSDGF
KSNLADNFTSQLILKGITPEDINMIKTPVNYEELCKLAVTYSDGVIQNSPTVNQKIMDYA
HELHIPVLDYQPADTFADACDAFYDQVWENAENK

Enzyme Prediction     

No EC number prediction in MGYG000001039_02521.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	5	237	3.4e-45	0.4682203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	1.67e-56	6	243	1	224	Starch synthase catalytic domain.
PRK14098	PRK14098	3.57e-49	5	214	7	223	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	1.07e-36	5	243	1	223	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	2.86e-28	5	246	2	215	glycogen synthase GlgA.
COG0297	GlgA	1.62e-27	5	244	2	233	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY34869.1	2.70e-171	1	272	1	273
QRO25341.1	5.86e-171	1	273	1	274
QJR63829.1	1.24e-158	1	269	1	270
QJR68092.1	1.24e-158	1	269	1	270
QJR59630.1	1.24e-158	1	269	1	270

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RZU_A	3.86e-09	6	194	3	181	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
6GNE_A	2.35e-07	6	236	12	237	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
6GNG_A	1.44e-06	6	202	42	245	GranuleBound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa],6GNG_B Granule Bound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3EGV0	1.97e-43	5	228	7	238	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
B4SC83	2.75e-43	5	214	7	223	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1
Q3B6C3	7.60e-42	5	228	7	238	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
A1BIY8	2.05e-41	5	214	7	223	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1
A4SCU9	5.54e-41	5	214	7	223	Glycogen synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) OX=290318 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999493	0.000430	0.000071	0.000003	0.000002	0.000029

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001039_02521.