CAZyme Information: MGYG000001040_00021

Basic Information

• Species: Prevotella sp900554045
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900554045
• CAZyme ID: MGYG000001040_00021
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
954		104782.47	5.536

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001040	2860396	MAG	Denmark	Europe

• Gene Location: Start: 18096; End: 20960 Strand: +

Full Sequence      

MELKKHLFLFIGALTCSLAMAQTHTDVSSVSASTNQHEASLVFDNDLGTVWNLDKSALSK
EQWLMFTLQTPGDVCEIDLQAQGLSKNDLKRQMSVFVTYDPMNLGVPVDYTVTGDAKKLT
LKFEPKYGAHVRLAFNCAEGMKPFALKEVSVLLAKKEMTDRKGNKTDLPYMDPTMPVEER
VESLLGVMKPEDKMELIREGWGIPGIPHLYVPPITKVEAVHGFSYGSGATIFPQAIALGA
TFNKKLAEATAMAIGDETVAAGTMQAWSPVLDVAQDARWGRCEETYGEDPVLVSEIGGAW
IKGYQSKGLFTTPKHFGGHGAPLGGRDSHDIGLSEREMREVQLVPFRHVIRNYGCQSIMM
AYSDYLGVPVAKSKELLQNILREEWGFDGFIVSDCGAIGNLTSRKHYTAKDKIEAANQAL
AAGIATNCGDTYNDKDVIQAAKDGRINMENLDNVCRSMLRMMFRNELFEQEPKPKLDWNK
IYPGWNSDDHKALARQVARESIVMLENKDAMLPLSKSVGTIAVIGPGADDLQPGDYTPKL
QPGQLKSVLTGIKQAVGNGTRVIYEKGCEFTGEDGTGIQAAVKAAKKADVVVMVLGDCST
SESTTDVYKTSGENNDYATLVLPGKQQELLEAVCAAGKPVVLVLQAGRPYNLTKAKDMCK
AILVNWLPGQEGGPATADVLFGDYNPAGRLPMTFPRHVGQLPLYYNFKTSGRRYEYSDME
FYPLYSFGYGLSYTSFEYSGLKVEEKENGNVAVQATVKNVGQREGDEVVQLYVTDMYASV
KTRVMELKDFTRVSLKPGEAKTVSFELTPYQISLLNDHMDRVVEKGEFKICVGGTSPQYV
AKDKIKDSVGYKDGKSGVSAMLDYTHEFAADFGLSVAKEEDNIKENSKTIYVAVKNNGTI
MDTGKVEMYVNGTKTGDAVHYELGPSEEKLIPFTVAKDGGNDVMFTTKYKAVNL

Enzyme Prediction     

No EC number prediction in MGYG000001040_00021.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	206	426	6.4e-70	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.86e-153	230	833	118	751	beta-glucosidase BglX.
PLN03080	PLN03080	5.51e-94	166	833	38	769	Probable beta-xylosidase; Provisional
COG1472	BglX	2.67e-84	195	561	44	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.16e-59	502	733	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.66e-57	158	461	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89549.1	0.0	1	954	1	954
QDO67869.1	0.0	1	954	1	954
QRQ47314.1	0.0	1	954	1	954
QUT46488.1	0.0	1	954	1	954
QIU96998.1	0.0	1	954	1	954

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	4.35e-124	170	836	7	745	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	3.27e-123	170	836	7	745	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5TF0_A	7.94e-107	183	836	61	740	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5Z9S_A	2.37e-105	168	836	15	775	Functionaland Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
5Z87_A	3.55e-105	211	836	123	774	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	2.09e-129	177	836	33	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	6.86e-122	153	833	41	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	2.24e-117	206	836	99	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
P14002	1.37e-91	181	846	5	667	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
T2KMH9	1.28e-87	205	839	120	747	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002347	0.913353	0.083077	0.000526	0.000339	0.000325

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001040_00021.