CAZyme Information: MGYG000001040_00027

Basic Information

• Species: Prevotella sp900554045
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900554045
• CAZyme ID: MGYG000001040_00027
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MGYG000001040_4|CGC1	36442.44	8.6964

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001040	2860396	MAG	Denmark	Europe

• Gene Location: Start: 5100; End: 6074 Strand: -

Full Sequence      

MKKLFISLLAVLFTATAYAAGKYDNPDTLFVARDGTGQFRTVSEAVEVCRAFMEYHKVIY
VKNGVYKEKIVIPSWLTNIEICGESADNTIITYNDHANIRLPETTKPMGTFRTYTVKVEG
SDITFKNITIENNAAKLGQAVAIHTEGDRITFIGCRLLGNQDTVYTGVGGTRLYFKDCYI
EGTTDFIFGPSTAWFENCTIHSKANSYVTAASTPQDVQFGYVFNRCRLTAAPGITKVYLG
RPWRPYAYTLFMNCDLGGHIVAAGWHNWKNPKNEQTARYREYNNTGDGAKTSERVSWSKQ
LTKKEAAQITLENVLKDWKPTMLN

Enzyme Prediction     

No EC number prediction in MGYG000001040_00027.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	30	316	7e-103	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	3.12e-82	29	308	7	289	pectinesterase
pfam01095	Pectinesterase	1.19e-74	31	310	4	290	Pectinesterase.
PLN02682	PLN02682	7.27e-69	28	306	70	352	pectinesterase family protein
PLN02432	PLN02432	6.02e-67	31	318	15	285	putative pectinesterase
COG4677	PemB	6.59e-64	26	318	80	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84477.1	1.60e-175	1	322	1	325
QVJ81978.1	2.25e-172	1	320	1	322
ADE82952.1	2.25e-172	1	320	1	322
AGB28242.1	2.11e-161	1	310	1	310
QJR97878.1	1.68e-159	23	320	16	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	5.53e-43	31	308	11	294	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	6.71e-39	31	297	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	4.68e-38	29	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.52e-37	29	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	9.94e-33	39	322	18	341	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.94e-58	31	306	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	1.21e-52	28	309	272	558	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q42608	1.98e-50	28	309	259	545	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q8VYZ3	7.89e-50	33	306	90	366	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
O23038	1.49e-48	24	307	86	374	Probable pectinesterase 8 OS=Arabidopsis thaliana OX=3702 GN=PME8 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000272	0.999071	0.000173	0.000166	0.000156	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001040_00027.