CAZyme Information: MGYG000001040_02358

Basic Information

• Species: Prevotella sp900554045
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900554045
• CAZyme ID: MGYG000001040_02358
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609	MGYG000001040_245|CGC1	68307.43	7.9282

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001040	2860396	MAG	Denmark	Europe

• Gene Location: Start: 6946; End: 8775 Strand: -

Full Sequence      

MKLKICLVALALPVVLCAPARQGDACRQFAPDEVKLLPSRFRDNFVRDSAWMMSVPVNSL
LHSFRNTAGVYSGHEGGYDTVEKLGGWESLDCDLRGHVTGHIMSALAMLYAQTGNPAVKA
KADSIVGGLAEVQCAYGTGYLSAFGQGLIDRNIQGKSVWAPWYTLHKLLQGLIDQYTLCH
SDSALAVARRMGEWAYGKTHALDDATRRRMLRNEFGGFNDAMYQLYQITGDARFLETARF
FYHNEKIDPLKAGNADLGTAHANTFIPKLLGECREYDISGSEDSRRAACLLFNTLSQEHA
FVTGEVSDKEHLFNPDEQHKHLTGYDGENCCTFNLLKLAARVFSWSADKRAADYIERALY
NHILGQQDTQSGMVTYFTPLLTGAYRLYSTPRQSFWCCVGSGFESHVGYASYIYFHNDTD
LYVNLFIPSELRWGGTTVRQETAFPRQGTTVLTVGGETKEFAMHLRRPWWAASMTVRLNG
KKVKTDGDGAVLKRKWRKGDRVEVAYGMELREEAVRGDSSRVALLYGPVVMAGCLGSVEK
PFSDPSKHNDYYTFDYKVPAGLAEKTRIKGASDLKKNAPLDYTTPQGVRVKPFYDVHHER
YVVYWNKTE

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	33	532	1.6e-172	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	9.62e-173	33	532	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	5.15e-105	85	545	56	514	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	3.30e-04	587	605	66	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU00179.1	1.83e-231	33	606	50	637
QUT34119.1	1.83e-231	33	606	50	637
ALJ62034.1	8.48e-230	33	609	50	640
QUT92215.1	3.42e-229	33	609	50	640
ALA72158.1	1.53e-227	27	606	43	636

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.61e-86	29	608	28	651	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	5.36e-82	29	608	28	651	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	4.71e-18	221	560	197	583	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	1.45e-17	152	530	125	543	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QK0_A	1.03e-16	221	560	197	583	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000250	0.999092	0.000192	0.000155	0.000138	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001040_02358.