CAZyme Information: MGYG000001041_00188

Basic Information

• Species: UMGS1648 sp900553765
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UMGS1648; UMGS1648 sp900553765
• CAZyme ID: MGYG000001041_00188
• CAZy Family: GT4
• CAZyme Description: Processive diacylglycerol alpha-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344	MGYG000001041_47|CGC1	39487.36	6.6705

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001041	1034312	MAG	Denmark	Europe

• Gene Location: Start: 1435; End: 2469 Strand: +

Full Sequence      

MKVLLHSDKQEQIAKSGVGRAIVHQQEALRLNGVEYTLDPKDTDYDIIHINTIFPESYLM
GKKAKKMGKKVIFHAHSTEEDFRNSYLLTNQVAPLFKKWLCKLYSSADLIITPTPYSKRL
LDNYGLGKPIIAISNGIDLDFYKQDTKKAENFRKKYGFSDTDKIIISVGLYIERKGILEF
VELAKKMPEYQFIWFGYSNLNTVPSKIKEAVQTKLDNLHFPGYVSREDLRDAYLGSDLFL
FMTHEETEGIVLLEALASKIPTLVRDIPIYEGWFEDGKNIHKASTLPEFEEKIHGILNHT
LKDVTEAGYKVAEERDIKSIGAELKKAYERVLSEPEKPELEETK

Enzyme Prediction     

No EC number prediction in MGYG000001041_00188.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	155	294	3.1e-18	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03817	GT4_UGDG-like	5.82e-30	24	334	64	371	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
cd03801	GT4_PimA-like	6.24e-29	44	329	82	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.03e-26	36	334	75	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03798	GT4_WlbH-like	3.59e-18	45	331	96	376	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.
cd03809	GT4_MtfB-like	2.45e-17	95	268	130	302	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH21109.1	2.72e-134	1	338	1	338
QQB61989.1	1.19e-132	1	337	1	335
QUO33398.1	9.91e-132	1	337	1	336
BBM17542.1	2.08e-131	1	335	1	336
CDZ75579.1	2.67e-131	1	329	1	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IV7_A	1.92e-09	138	301	172	335	CrystalStructure of WaaG, a glycosyltransferase involved in lipopolysaccharide biosynthesis [Escherichia coli str. K-12 substr. W3110]
2IW1_A	1.92e-09	138	301	172	335	CrystalStructure of WaaG, a glycosyltransferase involved in lipopolysaccharide biosynthesis [Escherichia coli str. K-12 substr. W3110]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8KQL6	6.66e-92	1	332	1	328	Processive diacylglycerol alpha-glucosyltransferase OS=Acholeplasma laidlawii OX=2148 GN=dgs PE=1 SV=1
Q8DPV9	1.08e-20	46	314	79	351	Alpha-galactosylglucosyldiacylglycerol synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=cpoA PE=1 SV=1
Q93P60	1.27e-13	46	279	88	333	Alpha-monoglucosyldiacylglycerol synthase OS=Acholeplasma laidlawii OX=2148 GN=mgs PE=1 SV=1
A7TZT2	3.69e-13	103	264	190	363	Mannosylfructose-phosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=mfpsA PE=1 SV=1
P25740	1.05e-08	138	301	172	335	Lipopolysaccharide core biosynthesis protein RfaG OS=Escherichia coli (strain K12) OX=83333 GN=rfaG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001041_00188.