CAZyme Information: MGYG000001041_00394

Basic Information

• Species: UMGS1648 sp900553765
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UMGS1648; UMGS1648 sp900553765
• CAZyme ID: MGYG000001041_00394
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558		65447.42	7.8466

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001041	1034312	MAG	Denmark	Europe

• Gene Location: Start: 1500; End: 3176 Strand: +

Full Sequence      

MRRVSEMWNRVSERLDRWDFLILFLIVLGYGIFSFWNLGSTKSPQTFYTFQNSNDEIIIE
LLKGEEYVTHVRYFVGEHPGMYNISISSDGEIYTMLPTESEKYVFTWNDIEIKERTKYIK
IESVEEGSQIGEIQVYQSQNPLLTKVAGTDKLTDEKDTVPMEISYMNSAYFDEVYFARTA
YDYANGLPAYEWVHPPLGKLIQAIPVSLFGMSPFTFRMMGNISGILLIVVMYCFAKNMFH
HRSYALLAASFMMFDNFHFAQSRMGTVDTHLVLFILLSYWMMYRYIKLKDEDSFQRKLRT
LFLCGLFISCAIATKWTGLFAGLGLAIIFFIRLYQTYRKKKWDKEGTQTIIFCCFVFVLL
PLCIYIGSYFLFPKVSGHYVNNFSSLIDITQEVFEYHSSLKETHPFSSPWYTWPVMARPV
WYYANTTGPHYQTISGIGNPLVWWGGIIALLAYVMHYIKERKKEIPVCLIAIGCLFFSYI
PITRDMFLYHYFPVLPFIMLLLVWFVQKIQQITKSRAVLTTVLLCTILLFVYFYPVSSGA
NITQDVAKDRRWFESWYF

Enzyme Prediction     

No EC number prediction in MGYG000001041_00394.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	162	371	2.3e-54	0.9327354260089686

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	1.42e-22	394	554	11	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
pfam02366	PMT	5.78e-21	163	371	15	239	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1928	PMT1	3.63e-20	163	390	42	288	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG1807	ArnT	1.14e-14	163	534	25	365	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	1.36e-14	193	342	1	142	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH68061.1	2.60e-133	19	548	15	548
ADZ82369.1	1.88e-132	19	548	12	545
QUI22495.1	5.45e-106	19	558	406	969
BBI34061.1	2.71e-103	12	558	682	1241
AIQ72362.1	2.45e-100	14	558	2	592

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8NRZ6	8.22e-24	171	556	64	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
P9WN04	2.75e-19	171	556	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	2.75e-19	171	556	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	6.33e-19	171	556	67	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q59X23	8.27e-11	167	371	70	293	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999625	0.000069	0.000003	0.000000	0.000000	0.000336

TMHMM  Annotations     

start	end
20	39
213	235
269	286
301	330
350	372
441	458
465	482
487	506
518	540