CAZyme Information: MGYG000001042_00047

Basic Information

• Species: Prevotella sp000436595
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436595
• CAZyme ID: MGYG000001042_00047
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000001042_2|CGC1	42543.53	9.4036

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001042	3438278	MAG	Denmark	Europe

• Gene Location: Start: 32852; End: 33973 Strand: -

Full Sequence      

MNIKTIVAVLAMAFVIVPAAQAKGPAKDGREVKKQKWTSMAPRLDDAFFTTAEAARIGDN
LLYYQHTSGGWPKNMQLQDELTDNVRKRVDKMKTGRRYATIDNRATSTEMIYLARLYNAT
QDNRYRDAVIRGFGYLFEAQYDNGGWPQFYPLSKGYYTHITYNDDAMVNVLKLMRDAAKG
KAPFAFLPDSIKTKAQASLDRGVDCILKTQVVQDGKKTVWCAQHDEQTLLPAKARAYELP
SLSGQESDDIVLFLMSLSKPSQAIRDCIESAVAWFKSTKIIGKRIERFTNADGKPDYRVV
DCAQDDGPCKPLWARFYTLEDNRPFFCDRDGVMKFDISEIGYERRNGYSWYNSEGLKVLK
KYDEWKKKYGAGK

Enzyme Prediction     

No EC number prediction in MGYG000001042_00047.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	65	357	1.2e-118	0.9930555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	6.96e-150	65	359	1	289	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	7.10e-139	65	359	1	290	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT78007.1	4.61e-166	37	368	34	361
QRQ48738.1	8.24e-163	37	370	34	367
QUT45489.1	8.24e-163	37	370	34	367
QUT93421.1	6.24e-157	30	368	26	361
ALJ61046.1	8.86e-157	30	368	26	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	4.43e-73	47	368	76	407	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	3.68e-64	51	359	30	323	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	5.72e-63	51	359	30	323	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000195	0.999141	0.000181	0.000184	0.000166	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001042_00047.