CAZyme Information: MGYG000001042_00091

Basic Information

• Species: Prevotella sp000436595
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436595
• CAZyme ID: MGYG000001042_00091
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574		65070.08	9.3943

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001042	3438278	MAG	Denmark	Europe

• Gene Location: Start: 1382; End: 3106 Strand: -

Full Sequence      

MRKQDNRYIWILLVICILSLIIFLGNALFNTKGEPREAIVAVSMLKYGNWILPINNGVDI
AYKPPFFHWCIAFFSLFQGYVSEFTSRLPSALALIAMTFVGFKFYEKRSTPQIALIECLV
AITSFEVHRTGTNCRVDMLLSALMVISLYQLYKWGEKGLRGVPVVAILCMSAAFLTKGPV
GIVLPCLVTAVFLLIRGYRFVKLLYAFALVALASCVIPACWYVAAYMQGGDTFMQLVYEE
NVLRFLGKMSYSSHENPAYYNVITVLSGYLPYTLLVVMSLFVLKYKKPEGTLKSWWNRLV
DYIKSMDDTRLFSLLSIVIIFIFYCIPKSKRSVYLLPIYPFIAYFLAEYIIYLAKNHSRI
IRSFGYTLSGIYIALLALFVAVRAGIVPETIFSGKHAAENIAQMRALETAGIGITDIIII
LLPVIAALLFWKSRKSDSIRQVYSMLGIVIAIFMSLDGFFQPIVLNTKSDKPVAMKLNSI
VGDGTVYSYRPQSAAGDPMRSFTINFYMNDRVVPFEAAMPKSGYMLSGNDDIEAFKETYP
DYSVTEVVDFKHKSCDDKKMLHLYQIYDTSRNKR

Enzyme Prediction     

No EC number prediction in MGYG000001042_00091.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	477	2.9e-77	0.8203703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.82e-27	5	381	6	369	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	4.34e-09	7	387	6	372	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.65e-06	63	221	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam10131	PTPS_related	7.78e-04	138	234	80	176	6-pyruvoyl-tetrahydropterin synthase related domain; membrane protein. This domain is found in various bacterial hypothetical membrane proteins, as well as in tetratricopeptide TPR_2 repeat protein. The exact function of the domain has not, as yet, been established.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVC44698.1	4.04e-32	1	492	1	467
ACD31278.1	4.08e-32	1	492	1	468
ALK94306.1	7.44e-32	1	492	1	468
AJI64859.1	1.35e-31	1	492	1	468
QHV77071.1	1.35e-31	1	492	1	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.39e-08	10	340	33	354	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	2.66e-19	13	388	6	363	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
O67601	2.13e-12	12	364	5	321	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000018	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
83	105
158	175
179	198
203	225
261	283
310	327
331	353
365	387
409	431
443	465