CAZyme Information: MGYG000001042_02288

Basic Information

• Species: Prevotella sp000436595
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436595
• CAZyme ID: MGYG000001042_02288
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
561		62138	6.6838

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001042	3438278	MAG	Denmark	Europe

• Gene Location: Start: 54682; End: 56367 Strand: +

Full Sequence      

MRLTKQVFRLLAPCALLLPLQSVSAAIPGYPTYPDSTRLRGERWQAEYSRHSDSAWAKAL
PIVEKQAKEGRPYRPWASKPEDLLRANIPAFPGAEGGGAYTQGGRGGRVMVVTTLADSGP
GSFREACETGGARVIVFNVAGVIRLKSPISIRAPYVTIAGQTAPGDGVCITGHSVLIDTH
DVIIRHMRFRRNNPDVMFRDDALGGNGVGNIIIDHCSGSWGSDENMSMYRHVYDRGGKNL
KLPTVNITIQNSIFSEALDLYSHAFGATIGGHNCMFNRNLFASNICRNASVGMDGTFNFV
NNVVYNWWSRTIDGGDHKSFYNIINNHYKPGPITMELKDRPCSHRILKPEPRRDKNLPTL
FGKAYVDGNIMEGYPEITKDNWNGGVQVFEEETCGEYTDKIRAYEPFEMPHVTILPTDSV
MPYVLANVGATLPRRDAVDTRVIETVRTGKAIYVDNAPIVTSPYQERALAPDSYKKGIIT
DPRQVGGLPEYKGTPYKDSDNDGMPDDWEVKYGLDPHNPADASADCNGDGYTNIEKFINN
IDPTVKVDWTDPRNNRDTLDV

Enzyme Prediction     

No EC number prediction in MGYG000001042_02288.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	140	328	5e-62	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00656	Amb_all	3.00e-06	142	321	3	180	Amb_all domain.
pfam18884	TSP3_bac	0.001	498	519	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.
COG3866	PelB	0.005	86	254	26	195	Pectate lyase [Carbohydrate transport and metabolism].
pfam03495	Binary_toxB	0.005	498	552	2	75	Clostridial binary toxin B/anthrax toxin PA Ca-binding domain. This domain is a calcium binding domain in the anthrax toxin protective antigen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT84043.1	6.54e-291	5	559	5	553
QJR68105.1	5.35e-290	5	559	5	553
QJR55559.1	5.35e-290	5	559	5	553
AII69027.1	5.35e-290	5	559	5	553
ALA74794.1	5.35e-290	5	559	5	553

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	2.16e-51	88	544	20	416	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	1.56e-49	88	544	20	416	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
Q4WL88	1.12e-47	88	544	21	417	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B0XMA2	1.56e-47	88	544	21	417	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
A1DPF0	4.16e-47	88	544	21	417	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000291	0.999056	0.000189	0.000163	0.000140	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001042_02288.