CAZyme Information: MGYG000001043_00256

Basic Information

• Species: CAG-877 sp900753325
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-877; CAG-877 sp900753325
• CAZyme ID: MGYG000001043_00256
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		42499.68	4.9845

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001043	1039027	MAG	Denmark	Europe

• Gene Location: Start: 76977; End: 78113 Strand: -

Full Sequence      

MKKILMVLFGVLVVLLLVFIFENRNIKSNEIVDKKTSGTGELFEKYYDKALDLLDNMTLK
EKVGQLFLVRYDKDMVPSWTSDYYASGYVLFAKDFNNQTKESIKEELSNLNKISKIPLVF
AVDEEGGYVTRVSRYPNFRSQKFPSPREVYEAGGEELLESVEKEKGELLLSLGINLNLAP
VADVSTDSNDFINNRTFNMNAKDTAYLIGKMVSYANEVPISSSLKHFPGYGNNVDTHTGI
AIDERSYENFVNNDYLPFKEGIKNKVPTILVSHDIVKCMDEEYPATLSKKVIGELRGKLK
FSGIIITDDLSMGAVKDYVSDGSAAVLAINAGNDLIITSDFKNMYNSVYEAINNGKIDIK
TVDMAVKRILAWKIAYDM

Enzyme Prediction     

No EC number prediction in MGYG000001043_00256.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	114	337	8.3e-40	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	2.99e-57	58	370	1	314	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	2.22e-48	57	376	1	315	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	2.16e-28	87	336	28	277	beta-hexosaminidase; Provisional
PRK15098	PRK15098	5.39e-18	52	378	40	356	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASW43722.1	6.74e-111	22	374	40	383
QHQ63470.1	4.83e-110	49	374	84	409
AYH39956.1	5.84e-102	43	375	180	512
BCJ98858.1	3.30e-101	44	374	122	452
BCI61427.1	4.75e-101	22	373	132	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.21e-35	57	373	11	337	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.81e-34	50	378	35	398	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	7.39e-34	50	378	9	372	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	8.75e-34	50	378	39	402	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
4ZM6_A	1.10e-26	59	373	9	337	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	9.91e-34	50	378	35	398	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	3.14e-26	81	373	60	380	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
D4AQ52	1.18e-25	80	371	46	346	Uncharacterized secreted glycosyl hydrolase ARB_06359 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_06359 PE=1 SV=1
L7N6B0	2.17e-23	116	373	116	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1
P44955	3.49e-23	86	357	27	294	Beta-hexosaminidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.772931	0.207962	0.017290	0.000282	0.000266	0.001282

TMHMM  Annotations     

start	end
4	21