CAZyme Information: MGYG000001044_00284

Basic Information

• Species: Campylobacter sp900753405
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter; Campylobacter sp900753405
• CAZyme ID: MGYG000001044_00284
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547	MGYG000001044_10|CGC1	63013.55	8.9634

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001044	1440385	MAG	Denmark	Europe

• Gene Location: Start: 56371; End: 58014 Strand: +

Full Sequence      

MRSVALVLLFFGALFAKNFDFAQLSELPKSLAKDYYIYRFLPQANQSELSLIRLQIHAFR
GKIKSLFEEKMPSEESLVCGSVTAKYFTKLSPECQERHISLKIIRELSKRDLKKVKKTFA
NNSKITTLIAAATAKSPAAFFASKQDADGYFSFFYKLKDEELQAYIQTPLPKNFADKIAS
HWRFANFISSLVLSKKNRDFALNFLEFDESKMSYKAAFSLGLLAILNDREERAKEFFSHA
ANATKRAFERDNAAFWVYLITNQEEDLRRVAQSGDVNIYTLYAKEALGDESEFLIASPLP
TKEKLAGYDITDPFVWLRTKERFARLKGEEFLTQIEQFYTKETLGEYSYLMERFYDYKIA
FFSMPHQHLLEGVTPERQALIYALMRQESRFVAGQVSVSYALGLMQFMPFLSRDIGKKLA
IENFDEDDVFKPQIAFEFANFHLDYLEKFLFNPTLVAYAYNGGIGFTSRFLKTGDYFNPA
SPHISYEPFLSMELVAYEESKIYAKKVLANYVIYLKLLGSNASILPLLQNLMKPAESDFF
RAKLAAK

Enzyme Prediction     

No EC number prediction in MGYG000001044_00284.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	2.83e-35	378	517	21	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	2.24e-20	379	511	20	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	7.44e-20	378	525	154	294	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	6.93e-18	379	511	2	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.83e-17	380	472	14	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARR03748.1	1.14e-141	20	545	24	552
ARR02031.1	1.61e-141	20	545	24	552
ARQ97721.1	3.23e-141	3	545	8	552
ARR00842.1	9.13e-141	20	545	24	552
ABK83257.1	2.19e-138	20	544	7	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6CF8_A	2.16e-111	18	538	2	520	Crystalstructure of Cj0843 lytic transglycosylase of Campylobacter jejuni at 1.87A resolution [Campylobacter jejuni]
6CF9_A	1.21e-110	18	538	2	520	Crystalstructure of soluble lytic transglycosylase Cj0843 of Campylobacter jejuni at 2.3A resolution in I23 space group [Campylobacter jejuni],6CFC_A Crystal structure of soluble lytic transglycosylase Cj0843 of Campylobacter jejuni in complex with Bulgecin A [Campylobacter jejuni]
7LAM_A	2.17e-110	18	538	22	540	ChainA, Lytic transglycosylase domain-containing protein [Campylobacter jejuni],7LAQ_A Chain A, Lytic transglycosylase domain-containing protein [Campylobacter jejuni]
6FBT_A	6.42e-07	362	514	445	592	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	6.58e-07	362	514	474	621	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000280	0.999147	0.000143	0.000153	0.000139	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001044_00284.