CAZyme Information: MGYG000001044_00596

Basic Information

• Species: Campylobacter sp900753405
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter; Campylobacter sp900753405
• CAZyme ID: MGYG000001044_00596
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	MGYG000001044_13|CGC2	36822.69	9.9979

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001044	1440385	MAG	Denmark	Europe

• Gene Location: Start: 120700; End: 121707 Strand: -

Full Sequence      

MKTAQNAPKQPAKIALIRLSALGDIVQSAIVAYFVKKNLPNSNLTWFCDEKFGTIARLCC
GVDEVVELPLKAKKFAKSWEILRQRRGEFDSVIDLQGLLKSAVVARILAPKPSGFSPKST
KEFAAGLLYAQKTQVSYNENIIIRNLTLASNALKFAWNREEVLAKPALFKVSKSEFESGV
LVAPFSSQASKNYTHFDEVIALVKESFKGEIYICAGSQKEREEAQKLAQKSGVKLLPPLD
LTQMTNLVSHAKLVIGNDSGITHLAWAQNTKSITLFGNRPSARNAYATPQNIVLDAGKKI
DARRIDESDFCINQICPKLVAKRALELLEKGGGDA

Enzyme Prediction     

No EC number prediction in MGYG000001044_00596.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	79	300	3.8e-32	0.9066666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02193	heptsyl_trn_I	9.75e-61	13	305	1	311	lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0859	RfaF	7.89e-49	13	330	3	332	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	7.50e-40	13	297	1	243	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	2.00e-32	85	278	9	211	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10964	PRK10964	1.03e-20	13	277	2	280	lipopolysaccharide heptosyltransferase RfaC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALV65378.1	3.52e-104	13	330	2	322
AGZ82208.1	4.99e-104	13	330	2	322
AVK81623.1	4.99e-104	13	330	2	322
ARR01019.1	7.84e-103	13	328	2	314
AJB45936.1	8.11e-103	13	330	2	322

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	9.81e-19	13	300	2	304	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	9.81e-19	13	300	2	304	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	1.07e-18	13	300	2	304	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24173	9.24e-18	13	277	2	280	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
P26469	1.76e-15	13	277	2	280	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2
Q57336	1.40e-11	11	293	8	299	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001044_00596.