CAZyme Information: MGYG000001044_01067

Basic Information

• Species: Campylobacter sp900753405
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter; Campylobacter sp900753405
• CAZyme ID: MGYG000001044_01067
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
255	MGYG000001044_19|CGC1	29719.42	8.8963

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001044	1440385	MAG	Denmark	Europe

• Gene Location: Start: 4158; End: 4925 Strand: +

Full Sequence      

MKIFIINLPAQRQRRENITKTLNLLGLKFELINAICGKDLSCEEKQNALDSSRADEFKRA
LSDGEIGCFLSHRLALEKFLQSECEDCVILEDDAVIDERLLEFLSLIPRLPKACELVLLG
HYRQVYLDDGFRIESPFSLRFDYELNEIYHLKRLVGGGLGSHGYFITRAGAGRLLAATER
FFKPFDHYTSDESVVNIFALYPVAVEFELNSHSSVQENRKIKRRSKIAKYFKRFRKWLMF
LPKSLKKPREYEVRK

Enzyme Prediction     

No EC number prediction in MGYG000001044_01067.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	2	187	1.6e-34	0.9723756906077348

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06532	Glyco_transf_25	6.76e-36	2	188	1	127	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
pfam01755	Glyco_transf_25	6.22e-31	2	189	3	200	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
COG3306	COG3306	1.56e-27	1	255	3	250	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJD05249.1	2.09e-74	1	252	1	257
ALW65481.1	9.65e-73	1	252	1	257
CDH62979.1	9.65e-73	1	252	1	257
ALW24092.1	9.65e-73	1	252	1	257
ALW44718.1	9.65e-73	1	252	1	257

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8IYK4	4.15e-09	2	123	343	472	Procollagen galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=COLGALT2 PE=1 SV=1
Q29NU5	5.58e-09	3	97	344	442	Glycosyltransferase 25 family member OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA16561 PE=3 SV=2
Q6NVG7	7.50e-09	2	123	342	471	Procollagen galactosyltransferase 2 OS=Mus musculus OX=10090 GN=Colgalt2 PE=2 SV=2
Q7Q021	1.78e-08	3	93	321	415	Glycosyltransferase 25 family member OS=Anopheles gambiae OX=7165 GN=AGAP012208 PE=3 SV=4
Q17FB8	5.85e-08	3	93	325	419	Glycosyltransferase 25 family member OS=Aedes aegypti OX=7159 GN=AAEL003481 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001044_01067.