CAZyme Information: MGYG000001045_00645

Basic Information

• Species: Enterocloster sp005845215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp005845215
• CAZyme ID: MGYG000001045_00645
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000001045_19|CGC2	42183.74	5.0393

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001045	5511723	MAG	Denmark	Europe

• Gene Location: Start: 29797; End: 30915 Strand: -

Full Sequence      

MTTERLKAKTNQVAYKLLHLGGADYDKDKNISIEEAIATGNVARDFGIEEWDWPQGVGLY
GLYMLYEQNGDESYMKFFEDWFRKNIERGLPSRNINTTEPYLTLLQIMDRLPRKDMYEEM
CMNQADWLIHELPKTGDNGFQHVTSGIGDRNGVILNEGQLWVDTLFMAVLFLQQMGNRYN
NPEWKAEALHQVLVHIKYLYNKNNGLFYHGYSFIRRDNFGGIFWCRGNSWFTLGITLYLE
QAADLDEGTRRYLLDTFKAHAEALRSCQAESGLFHTILDDPDSYEEASGTAAIAAGLLRG
VRQGILDKSFEHCANKAIEALCDCVAQDGTVLKVSAGTAMGMDSEHYKNIGLRPMAYGQA
LTLIAFAEALRG

Enzyme Prediction     

No EC number prediction in MGYG000001045_00645.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	371	3.4e-93	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	5.76e-93	50	371	33	351	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	6.91e-84	50	371	26	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ40335.1	1.62e-165	1	371	1	371
AIQ71725.1	1.88e-164	1	371	1	371
AIQ28570.1	2.67e-164	1	371	1	371
QUL56643.1	6.19e-164	1	370	1	370
QNK60567.1	8.40e-164	18	371	1	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	6.61e-78	4	371	24	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.08e-73	27	371	42	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	7.09e-72	37	371	33	370	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	1.09e-13	49	321	21	298	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.63e-12	31	341	14	336	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.09e-50	25	371	6	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	8.95e-12	31	341	14	336	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001045_00645.