CAZyme Information: MGYG000001045_04966

Basic Information

• Species: Enterocloster sp005845215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp005845215
• CAZyme ID: MGYG000001045_04966
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
808	MGYG000001045_168|CGC1	90666.48	5.7755

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001045	5511723	MAG	Denmark	Europe

• Gene Location: Start: 14947; End: 17373 Strand: -

Full Sequence      

MTAERYIRQYTEEFMKLDRRFWNYEDGCVLTALEAMYKATGRERYAQAVRIFLDRYICSD
GRIKWYDSEEYSLDKILSGRALLFLYRETGEEKYRLAAKQLMEQLRHQPRTESGSFWHKK
IYPRQIWLDGLYMAAPFYLQYEMELGDRRNCGDVMKQFENARRFLYDEGTGLYIHAYDEG
KCQFWADPETGRSPNFWSRAEGWYLMALADCCSILPEGTEEWKYLAGLWKEAMDGMLRYQ
DRETGLFFQLTALGEIPGNYLETSASAMVAYSIYKGYETGVLDRGTADRADLIMMALETE
KLKVREGILHLDGTCAGAGLGPAGRPERDGSIGYYLGEPVVSDEQKGAAAFMLAYSQWIA
GGRNSLDTEETCVVKINDVYELRHRAVEQIELGYGKGTEKVDIPRDSIAHILVPHKKEES
RPEADIIEQALDSPLGTKRLEILAAGKKDVVIVTSDITRPMPSWKVLPHVLKRLEKAGVS
RSQVTVVFAVGTHRRQTREEMRHLAGDDIYNTCRCMDSSECSFIHMGETKAGTPVDIADK
VAQADLRICLGNIEYHFFAGYSGGAKAIMPGVSTMEAIRKNHSRMIHPMAKAGTLAGNPV
REDLEEAAGICGVDFLLNVVLDEHKNVIHAAAGDLKEAHRQGCRFLDGFYRTEINELADI
VIVSQGGAPKDLNLYQTQKALANAEQAVRPGGIIILAGACPEGLGGAVFEQWMLEAEDLD
SILERIQKDFRIGGHKAASFARALKRARIFLVSGIEPKLVRDIFMEPFDHVQEAYDAAVK
EIGPGARVIVMPYGGSTLPVLAGNRMPN

Enzyme Prediction     

No EC number prediction in MGYG000001045_04966.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	19	359	3.7e-95	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033504	Ni_dep_LarA	0.0	390	801	1	417	nickel-dependent lactate racemase. LarA from Lactobacillus plantarum is a nickel-dependent lactate racemase and the founding member of a family of isomerases that depend on a nicotinic acid-derived nickel pincer cofactor. While it is not yet clear which homologs of LarA act preferentially on lactate, this model identifies one clade of architecurally similar proteins from among a broader set of LarA homologs. Note that the crystal structure 4NAR, on deposit at PDB but not associated with any publication, represents a protein from Thermotoga maritima that falls outside the scope of this family and that is annotated in PDB as a putative uronate isomerase.
COG3875	LarA	2.62e-113	389	800	14	421	Nickel-dependent lactate racemase [Cell wall/membrane/envelope biogenesis].
COG4225	YesR	2.18e-82	2	356	15	351	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam09861	DUF2088	1.37e-71	394	587	1	197	Domain of unknown function (DUF2088). This domain, found in various hypothetical prokaryotic proteins, has no known function.
pfam07470	Glyco_hydro_88	9.07e-68	3	355	6	336	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASN96698.1	0.0	1	804	1	804
QRP38506.1	0.0	1	804	1	804
QJU19057.1	0.0	1	804	1	804
QTQ15312.1	9.98e-114	1	359	1	357
QTQ12711.1	2.78e-113	1	359	1	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6D6Z_A	2.57e-110	388	799	4	413	Structureof the 2nd lactate racemase homolog apoprotein from Thermoanaerobacterium thermosaccharolyticum [Thermoanaerobacterium thermosaccharolyticum DSM 571],7S91_A Chain A, Malate racemase Mar2 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
4WU0_A	1.71e-84	22	354	23	354	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
2YJG_A	2.00e-72	390	798	4	422	Structureof the lactate racemase apoprotein from Thermoanaerobacterium thermosaccharolyticum [Thermoanaerobacterium thermosaccharolyticum DSM 571],2YJG_B Structure of the lactate racemase apoprotein from Thermoanaerobacterium thermosaccharolyticum [Thermoanaerobacterium thermosaccharolyticum DSM 571]
5HUQ_A	8.84e-65	390	794	4	418	Atethered niacin-derived pincer complex with a nickel-carbon bond in lactate racemase [Lactiplantibacillus plantarum],5HUQ_B A tethered niacin-derived pincer complex with a nickel-carbon bond in lactate racemase [Lactiplantibacillus plantarum]
6C1W_A	8.84e-65	390	794	4	418	ChainA, Lactate racemase [Lactiplantibacillus plantarum WCFS1],6C1W_B Chain B, Lactate racemase [Lactiplantibacillus plantarum WCFS1],6C1W_C Chain C, Lactate racemase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D9TQ02	8.31e-72	390	798	4	422	Lactate racemase OS=Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIMB 9385 / NCA 3814 / NCTC 13789 / WDCM 00135 / 2032) OX=580327 GN=larA PE=1 SV=1
F9USS9	3.83e-64	390	794	4	418	Lactate racemase OS=Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) OX=220668 GN=larA PE=1 SV=1
O34559	3.58e-55	3	357	21	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.10e-36	133	357	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.10e-36	133	357	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001045_04966.