CAZyme Information: MGYG000001045_04973

Basic Information

• Species: Enterocloster sp005845215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp005845215
• CAZyme ID: MGYG000001045_04973
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466	MGYG000001045_168|CGC2	52569.91	5.1627

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001045	5511723	MAG	Denmark	Europe

• Gene Location: Start: 23596; End: 24996 Strand: -

Full Sequence      

MKWTNHHVSDIKMAYIGGGSKAWAWKLMADLALEPALDGTVWLYDIDARAAEENQIIGNQ
LKGRREASGQWDYRVAYSLKEALEGADFVVISILPGTFEEMRSDVHLPERLGIYQSVGDT
AGPGGMVRALRTLPMYEEIALAVRDICPKAWVISYTNPMSLCVASLYKTFPGIKAFGCCH
EVFGTQKVLAAIAAGELGTGPIDRRDIHVNVLGINHFTWFDAASYEGVDLFPVYREYIRT
HFEEGYDDPDRPWEESTFNCRHRVKFDLFNRYGLIAAAGDRHLAEFMPGSSYLNDPETVT
SWKFGLTTVDFRIHQMEERLARRKRLMEGEEQMEIVPSGEEGVQQIKALVGLDRMVSNVN
MPNSFLQIPNLPKEAVVETNAVFSRDSIKALAAGPLPESLRELILPHVENHGYILEAADT
YDRDLVVKAFMNDPLVKYKCRDEGAVRKLADDMIKNTEHYLPDGWK

Enzyme Prediction     

No EC number prediction in MGYG000001045_04973.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	12	192	4.4e-53	0.9888268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	8.41e-171	11	454	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	6.55e-93	11	462	4	437	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	1.83e-66	12	463	3	429	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	2.03e-56	12	190	1	178	Family 4 glycosyl hydrolase.
cd05296	GH4_P_beta_glucosidase	1.91e-43	11	454	1	412	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASN96705.1	0.0	1	466	1	466
QRP38499.1	0.0	1	466	1	466
QJU19050.1	0.0	1	466	1	466
SEU08117.1	2.14e-234	1	466	1	465
QOV18776.1	2.32e-229	1	466	1	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	3.42e-148	8	455	3	437	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	4.03e-29	11	466	5	439	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	6.66e-26	11	466	8	442	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
3U95_A	7.76e-18	11	437	1	442	Crystalstructure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_B Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_C Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_D Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_E Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_F Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359]
6VC6_A	6.52e-12	43	463	37	439	2.1Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis],6VC6_B 2.1 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis],6VC6_C 2.1 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis],6VC6_D 2.1 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9KTB9	1.66e-218	1	465	1	464	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
I3VRU1	1.18e-184	1	466	1	462	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	1.03e-182	1	465	1	453	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
P39130	1.17e-152	7	455	3	441	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
O34645	6.17e-48	12	463	3	430	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001045_04973.