CAZyme Information: MGYG000001046_00713

Basic Information

• Species: CAG-103 sp004556965
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-103; CAG-103 sp004556965
• CAZyme ID: MGYG000001046_00713
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588		66354.1	6.8419

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001046	1859156	MAG	Denmark	Europe

• Gene Location: Start: 3227; End: 4993 Strand: -

Full Sequence      

MSVISYTFPAAAICFVILLFLGLRREALLPPPQCVQRHGVLPILVITAVYAVAAFCNLGS
AAAPQSFCVFERGGSATLTLPETEAIGSIFYYTGLGTGDYTVALSTDGETYTDVGTMPQQ
YADLFKWKYAEFDDDADLTARYVRITAHGGTELGEVAVYRADGTKIDVSAAAALLDEQSL
VPDAPDWRNSTYFDEIYHARTAYEHLRGVQPYEVSHPPLGKLILSLGIALFGMTPLGWRF
MGTLFGVAMLPVLWDFLRRLFHDDRIAVCGTLLFAFDFMHFTQTRIATIDTYAVFFILLM
YLFLYRYFTEGKLRYLGLSGLFFGVGAACKWTCLYAGAGLGVLWLLHWIFRGVEDARAGE
GRAFTRALLGNIGFCLVFFVALPCCIYYVSYTPYATAAGLRGAGMYFTRDYFDIVWENQK
FMFTYHAGLEATHPYSAPWWQWLFDVRPILYYLEYGDGNTVSTIASFVNPLLCWAGLLSL
PVLGYQAVRQRDRRALFLLIGYLAQVLPWVFISRITFEYHYFPATVFLVLGLCNVFDLLR
RRGKLGSVYCFTAVCLALFLAYYPALSGLPMSRNYAWYFLKWFPSWPF

Enzyme Prediction     

No EC number prediction in MGYG000001046_00713.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	189	394	2.2e-52	0.9147982062780269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	9.52e-24	416	584	4	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	2.13e-18	417	588	503	695	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam13231	PMT_2	6.45e-15	215	347	1	132	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	3.46e-13	186	351	16	203	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	1.69e-11	212	471	132	352	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU42918.1	2.33e-172	37	588	63	653
QQR07704.1	2.33e-172	37	588	63	653
QIA32159.1	1.86e-170	37	588	59	649
ALP95330.1	4.16e-158	31	588	68	752
QBB67038.1	8.30e-158	31	588	68	752

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	4.94e-30	160	586	34	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	1.73e-29	193	586	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.73e-29	193	586	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	7.20e-18	214	586	97	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	23
40	62
235	257
292	309
324	346
367	389
461	483
495	517
521	538
545	567