CAZyme Information: MGYG000001046_01370

Basic Information

• Species: CAG-103 sp004556965
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-103; CAG-103 sp004556965
• CAZyme ID: MGYG000001046_01370
• CAZy Family: GT35
• CAZyme Description: Maltodextrin phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
801		90173.4	5.4445

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001046	1859156	MAG	Denmark	Europe

• Gene Location: Start: 1085; End: 3490 Strand: +

Full Sequence      

MSMTNQISRDELRSAIEDKLCAHYGVTALDATDEQVFQASAIVIREIMSRVLTFDSSVQP
EREVHYLSMEFLMGRSLMKNAFNLGVAEALEGALNDMGRSAADIFETEPDAGLGNGGLGR
LAACYMDSLATQDIPATGYSLCYELGIFRQKIENGRQTEVADNWRTAAEGWLVPRYEDTV
EVRFGGHVEAQWDNYGHYHGELKGYESVLAVPRDMLVAGYGNTRVNTLRLWEAHSPNDLD
MYLFATGDYVKSMEQRTMAEVITKVLYPADDHIQGKTLRIRQQYFFVSATAQSIVRDHRA
RYGTVRNFPEHHVIQINDTHPTLMIPELMRLFMDEDGLGWDEAWDIVTACVNYTNHTVMS
EALETWPQGLIQSQMPRVWEIICEINRRWCEYLRGRFGDDARVGRNLILADGKVHMANLC
LAACKTVNGVSGLHGDILKNDLFRDVCALSPERFTYVTNGIDHRRWLAQINPGLHRLVCD
LLGGDGYLLHPEELCKLNDFTSDPAVLARVEAIKRENKLRFAQYTAREGFTLDTDAILDV
QVKRLHEYKRQLLCAMLITALQQRLHDDPNQDFVPRTFVFGAKAAPGYATAKRIIQLLCS
LAADVNADPVCKGRLQVHFLENYRVSVAEVLMPAVQVSEQISTAGKEASGTGNMKMMMNG
AVTIGTLDGANVEMYERLGDRNMFLFGLHADEADALRARGYNPLDCVRNNDTLRRVLERM
NRGYADGESYSDLAGQLLYGGDPYLLLADFKSYVNCHDRLYATISDPAERARLSLVNTAE
SGVFAADRAVLEYAQRIWRVK

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	93	801	6e-238	0.9985163204747775

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14986	PRK14986	0.0	7	801	12	811	glycogen phosphorylase; Provisional
COG0058	GlgP	0.0	4	801	1	749	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	0.0	23	801	20	797	maltodextrin phosphorylase; Provisional
TIGR02093	P_ylase	0.0	16	800	1	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	13	800	1	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU40324.1	0.0	1	800	1	809
QQR06906.1	0.0	1	800	1	809
QIA32151.1	0.0	5	800	2	806
BCK80927.1	0.0	8	800	4	801
QBB67026.1	0.0	3	800	1	807

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1Z8D_A	6.05e-214	60	801	80	829	ChainA, Glycogen phosphorylase, muscle form [Homo sapiens]
3CEH_A	1.69e-213	60	801	57	806	Humanliver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEH_B Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEJ_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEJ_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEM_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens],3CEM_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens]
5OX0_A	3.52e-213	60	801	80	829	GlycogenPhosphorylase in complex with CK898 [Oryctolagus cuniculus]
3ZCP_A	4.98e-213	60	801	80	829	Rabbitmuscle glycogen phosphorylase b in complex with N- cyclohexancarbonyl-N-beta-D-glucopyranosyl urea determined at 1.83 A resolution [Oryctolagus cuniculus]
2GJ4_A	5.45e-213	60	801	68	817	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P11217	4.15e-214	60	801	80	829	Glycogen phosphorylase, muscle form OS=Homo sapiens OX=9606 GN=PYGM PE=1 SV=6
Q9XTL9	2.81e-212	60	801	80	829	Glycogen phosphorylase OS=Drosophila melanogaster OX=7227 GN=GlyP PE=2 SV=2
P06737	3.09e-212	60	801	80	829	Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL PE=1 SV=4
Q8HXW4	3.74e-212	60	801	80	829	Glycogen phosphorylase, muscle form OS=Macaca fascicularis OX=9541 GN=PYGM PE=2 SV=3
P00489	5.45e-212	60	801	80	829	Glycogen phosphorylase, muscle form OS=Oryctolagus cuniculus OX=9986 GN=PYGM PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001046_01370.