CAZyme Information: MGYG000001048_00278

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UBA7057
• CAZyme ID: MGYG000001048_00278
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 2D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492		55399.65	4.2501

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001048	1211990	MAG	Denmark	Europe

• Gene Location: Start: 881; End: 2359 Strand: -

Full Sequence      

MYGIQNAAKFYFDKNASELDWAEAAMLTGIPKSPSNYSPIVNFELAKQRQTNILYNLYQN
DVISEEEYNQAVNEELTIVGEKNSQELANIMYYQDAVMRELNSLEEIPDSLLETGGIKIY
TNLDMNAQSILENSIKNNLTEDTELQVASVMMDPNTGKIIALVGGKDYNKSQYNRAYQSA
RQVGSTMKPFLYYAALENGFTSSTTFTSEQTTFTFSNNQTYSPQNYGDQYGNKPISLATA
ISYSDNIYAVKTHMFLGEDALVNISKRLGITAELEEVPSLPLGTASINIIEMAAAYSAFA
NEGYKVEGYLISRVEDLKGNVLYEHKEEKENILNKSLTYILSELLTSTYDSTFIDYNYPT
AIGIAPKIKHKLALKSGTTNTDHWSIGYNHNIVTAVWIGYDDNRDIEASDYKYSRNIWVE
ATEGYLQDQEDAWYKQPSNVVGVLVNPITGKPATEADEKKKIMYYVKGTEPSSTDTVFDE
LLEQDEQILEQN

Enzyme Prediction     

No EC number prediction in MGYG000001048_00278.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	1.03e-132	2	428	110	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.89e-129	2	476	185	651	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	2.44e-97	2	475	175	768	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	2.92e-44	2	472	174	829	penicillin-binding protein 1a; Provisional
PRK09506	mrcB	2.49e-40	7	403	328	724	bifunctional glycosyl transferase/transpeptidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXM88984.1	8.10e-142	1	472	181	653
AKS39661.1	6.44e-141	1	472	181	653
QAV25609.1	1.44e-139	1	472	181	653
AST05997.1	3.23e-138	1	472	181	653
ASA97111.1	2.42e-137	1	472	181	653

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZG8_B	1.06e-49	2	401	27	433	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	1.79e-45	2	401	27	433	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
2JE5_A	1.53e-38	3	462	168	675	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]
4OON_A	2.78e-38	2	453	147	750	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3UDF_A	5.62e-35	2	435	147	725	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70997	3.32e-115	2	473	182	655	Penicillin-binding protein 2D OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpG PE=2 SV=3
O66874	1.17e-46	2	474	171	715	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P0A0Z5	9.54e-44	2	441	176	721	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1
P0A0Z6	9.54e-44	2	441	176	721	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1
O05131	9.54e-44	2	441	176	721	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae OX=485 GN=mrcA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001048_00278.