CAZyme Information: MGYG000001049_00899

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UBA1777
• CAZyme ID: MGYG000001049_00899
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353		37576.21	3.9755

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001049	2008199	MAG	Denmark	Europe

• Gene Location: Start: 26; End: 1087 Strand: +

Full Sequence      

MSLEEKVGQLFIIRPESLSTALTPQQAHDTTEYGVTEWTEDMAAQLEKYPAGGVAIFGKN
ISSPEQLKNFVAAMQQASSLPLFMGVDEEGGSVSRLANSPAFRTEEGYVLPQFKSMAEIG
ASGDTGAARTVGFTIGCYLQEYGFNLDFAPVADTNTNPDNVVIGDRAFGSDPELVSQMVA
ADLEGLHSAGVLGCIKHFPGHGDTVGDTHDGYVSIQKTWDELLSAELIPFINNLDNTDMV
MVAHISLPNVTGDGLPASLSGELISGKLRGDLGYDGVVITDSLAMGAIAQEYTSADCAVM
ALDAGVDILLMPEDYAAAFEGVVQAVEDGRLSMERINESVRRVLELKDQLGLL

Enzyme Prediction     

No EC number prediction in MGYG000001049_00899.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	74	311	4.4e-56	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	5.45e-86	1	353	1	318	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.02e-76	2	346	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	2.53e-49	36	311	11	279	beta-hexosaminidase; Provisional
PRK15098	PRK15098	4.14e-15	1	352	45	358	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT41975.1	3.02e-150	1	353	50	396
QIB69696.1	3.66e-146	1	353	50	396
CAB1254359.1	3.17e-143	1	353	63	410
CBL35090.1	2.07e-123	1	347	58	391
ATL88810.1	1.77e-116	1	352	42	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	7.26e-64	1	349	11	339	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.14e-60	1	352	42	398	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	3.91e-60	1	352	16	372	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	6.61e-60	1	352	46	402	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
4ZM6_A	4.05e-54	46	349	34	339	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	6.26e-60	1	352	42	398	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	2.56e-50	35	350	48	383	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
L7N6B0	2.14e-41	41	347	78	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1
A0A0H3M1P5	5.81e-41	41	347	78	380	Beta-hexosaminidase LpqI OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=lpqI PE=3 SV=1
Q4USG7	1.32e-39	36	322	9	290	Beta-hexosaminidase OS=Xanthomonas campestris pv. campestris (strain 8004) OX=314565 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001049_00899.