CAZyme Information: MGYG000001050_00708

Basic Information

• Species: UBA11490 sp003524095
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UBA1242; UBA11490; UBA11490 sp003524095
• CAZyme ID: MGYG000001050_00708
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337		37606.22	10.3495

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001050	1065888	MAG	Denmark	Europe

• Gene Location: Start: 76162; End: 77175 Strand: -

Full Sequence      

MPNLALIQNLKNYKIYYLGSNGMEKEIVSKHKNITFVEIPTVKFIRSLTLKNLLIPFKLI
KSISTCKKILKDIKPDIVFSKGGYVSVPVCLSASKLNIPVLTHESDLTVGLANKIIAKKA
KYLCCSFRETANSFGKNAIFTGSPVRNEIFNGNKNIVFKRHNITKNLPIILVVGGSLGAK
AINDAIFGSISKLAQKYFIIHIVGKNNLKQTKTPTKNYIQIEFSQDIEDYFDASDIVISR
AGSNTIFELLAIKKPMILIPLPKDSSRGDQILNAQNFEKHGLANIIYQEDLNTSTLLNKI
NYTLQNKAKYISAMSKLKFSCGNEKIISLIDKISTNK

Enzyme Prediction     

No EC number prediction in MGYG000001050_00708.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	170	316	3.4e-42	0.9299363057324841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	2.63e-117	1	333	16	354	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.81e-95	2	329	15	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	6.77e-91	2	318	16	336	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK12446	PRK12446	4.28e-89	1	334	16	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
TIGR01133	murG	3.80e-80	2	316	16	330	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF44674.1	2.02e-93	2	334	17	353
AQP39384.1	4.73e-93	2	337	17	356
CBL37237.1	6.69e-93	2	337	17	356
AUM88731.1	2.30e-92	2	332	17	351
AUN18621.1	2.30e-92	2	332	17	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	3.91e-32	2	307	25	336	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	8.95e-27	2	300	22	319	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	6.24e-26	2	306	18	324	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
6PNT_A	3.64e-06	235	337	335	435	StructuralCharacterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1KYH7	6.50e-93	2	332	17	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain Loch Maree / Type A3) OX=498214 GN=murG PE=3 SV=1
A7FX11	1.30e-92	2	332	17	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=murG PE=3 SV=1
A7GGX9	1.30e-92	2	332	17	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=murG PE=3 SV=1
B1IKH3	1.30e-92	2	332	17	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain Okra / Type B1) OX=498213 GN=murG PE=3 SV=1
A5I5J5	1.30e-92	2	332	17	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001050_00708.