CAZyme Information: MGYG000001054_00057

Basic Information

• Species: Succinivibrio sp900555115
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Succinivibrio; Succinivibrio sp900555115
• CAZyme ID: MGYG000001054_00057
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000001054_3|CGC1	38008.16	8.6636

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001054	2025835	MAG	Spain	Europe

• Gene Location: Start: 5201; End: 6274 Strand: -

Full Sequence      

MSKRILIMAGGTGGHVFPALAIAGELKKRGYEILWLGTRGRMEEKLVPKSGFPIEYIDVR
GIRRNGLKAKLSAPLMVCNAVRQALQVMKSFKPDAVLGMGGYASGPGGVAARLCGIPLAL
HEQNAAAGLTNRLLSKLATVIMLGFPGAFTGDRVRIVGNPVRNDILALYRRERDANNEKM
RVLVIGGSLGAQALNELVPKAISLLDKNILSVTHQCGGGHVEATQHAYEGCGADHEIREF
ITDMSAAYAEHDLIICRAGASTVAETACAGIPAIFVPLPTAVDDHQTKNAMFSVGHKAAL
LCPQKDLKPESLAELLKDLALHRDRLKAMSEAAYDCAVTDATQRAADLIDGIAASRS

Enzyme Prediction     

No EC number prediction in MGYG000001054_00057.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	182	341	2.6e-51	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.34e-167	2	355	1	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	3.13e-149	4	348	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	1.30e-137	3	349	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	2.46e-131	3	355	1	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam04101	Glyco_tran_28_C	1.31e-49	182	344	2	165	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHX59349.1	7.22e-124	1	357	1	357
QQQ13184.1	7.22e-124	1	357	1	357
QHQ52760.1	1.45e-123	1	357	1	357
QSO21682.1	1.68e-123	1	347	1	347
BCM73865.1	1.68e-123	1	347	1	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	1.93e-100	1	347	1	349	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	1.09e-99	3	349	10	362	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	1.50e-99	3	353	7	354	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4SI56	1.17e-123	1	357	1	357	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=murG PE=3 SV=1
A0KPX2	3.11e-121	1	347	1	347	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=murG PE=3 SV=1
C4LA25	2.37e-119	1	344	1	346	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=murG PE=3 SV=1
A1SU19	7.20e-116	3	348	5	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=murG PE=3 SV=1
A1S2F9	3.43e-115	3	348	7	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) OX=326297 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001054_00057.