CAZyme Information: MGYG000001054_00567

Basic Information

• Species: Succinivibrio sp900555115
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Succinivibrio; Succinivibrio sp900555115
• CAZyme ID: MGYG000001054_00567
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359		40414.66	5.3188

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001054	2025835	MAG	Spain	Europe

• Gene Location: Start: 3360; End: 4439 Strand: -

Full Sequence      

MKNAAIPALGIIEGFYGRSYKPKDRKFLIERIASFGYSFYIYGPKNDEILRKKWRSPLDA
QTTRLYKDLKECCMDAGMQASFALSPLKFTDLTDDEAASLVLDKISDMLALFTPSFICLL
FDDIPVEHDDLGVRQNTLLKNLLRALPPDLKLFVCPSFYSFDPVLEKIFGTMPENYFSDL
RHDIPPSRLKLFWTGNQVISASIKAEDIKKARTYTGSEIMLWDNYPVNDGKKICDKLFTA
PFFGRDTLKTLGKDFMHAVNPMCEAALSSIPLSSLPLIYKGAGQAEIEKAYDDELKLHFG
QNALRLKDFLKCCGEEGLEAASVYKDEILKDLSSVNTLGAAELRSYLNGEFAFDPACLT

Enzyme Prediction     

No EC number prediction in MGYG000001054_00567.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	10	307	1.2e-56	0.9796610169491525

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	2.46e-50	10	275	2	258	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQD19886.1	9.58e-66	9	359	8	355
ALP42587.1	4.19e-60	7	359	15	366
QCG48732.1	4.59e-59	6	359	14	366
AMO68516.1	1.36e-57	8	359	4	352
QFI54168.1	2.14e-56	7	359	15	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DIY_A	1.46e-27	10	304	8	301	Thermobaculumterrenum O-GlcNAc hydrolase mutant - D120N [Thermobaculum terrenum],5DIY_B Thermobaculum terrenum O-GlcNAc hydrolase mutant - D120N [Thermobaculum terrenum]
2XSA_A	2.09e-22	10	245	4	240	ChainA, Hyaluronoglucosaminidase [Oceanicola granulosus HTCC2516],2XSB_A Chain A, Hyaluronoglucosaminidase [Oceanicola granulosus HTCC2516]
7KHS_A	2.12e-22	10	245	6	242	ChainA, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516],7KHS_B Chain B, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516],7KHS_C Chain C, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516],7KHS_D Chain D, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516]
2XPK_A	1.32e-20	6	357	149	506	Cell-penetrant,nanomolar O-GlcNAcase inhibitors selective against lysosomal hexosaminidases [Clostridium perfringens],2XPK_B Cell-penetrant, nanomolar O-GlcNAcase inhibitors selective against lysosomal hexosaminidases [Clostridium perfringens]
7KHV_A	5.80e-20	6	357	149	506	CpOGAIN COMPLEX WITH LIGAND 54 [Clostridium perfringens],7KHV_B CpOGA IN COMPLEX WITH LIGAND 54 [Clostridium perfringens],7KHV_C CpOGA IN COMPLEX WITH LIGAND 54 [Clostridium perfringens],7KHV_D CpOGA IN COMPLEX WITH LIGAND 54 [Clostridium perfringens],7KHV_E CpOGA IN COMPLEX WITH LIGAND 54 [Clostridium perfringens],7KHV_F CpOGA IN COMPLEX WITH LIGAND 54 [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2CEE3	1.15e-21	10	245	4	240	Protein O-GlcNAcase OS=Oceanicola granulosus (strain ATCC BAA-861 / DSM 15982 / KCTC 12143 / HTCC2516) OX=314256 GN=OG2516_04129 PE=1 SV=1
Q8XL08	1.29e-19	6	357	179	536	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	1.36e-18	6	357	179	536	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001054_00567.