CAZyme Information: MGYG000001054_01313

Basic Information

• Species: Succinivibrio sp900555115
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Succinivibrio; Succinivibrio sp900555115
• CAZyme ID: MGYG000001054_01313
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
714	MGYG000001054_98|CGC1	80799.12	8.3595

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001054	2025835	MAG	Spain	Europe

• Gene Location: Start: 9876; End: 12020 Strand: -

Full Sequence      

MAHTLKALLALIIVLPILYFTVVTPMGAYAQLVFSCCMMGGCYVISSLSRKHSVSAILIL
VSVLLSTRYMYFRATQTLEFDSLLEAVCGYVLFFAECYIYVILLLSSFQNIWSLKRRVVP
MPDDTDEWPTVDVYIPTYNEPLEIVRNTVLAAQCLEYPRDKIAVYILDDGRRKELAQFAT
EAGVGYITRNDNAHAKAGNLNHAMKLTKGELIAIFDCDHIATRMFLQDTVGAFLKDKKLA
LLQTPHHFYSPDPIQRNLYLGRDIPAENELFYGNVQRGNDNWNACFFCGSCAVIRRRALD
EIGGFAVETVTEDAHTALKLQRRGWKTAYLDKILAAGLATERTILHIIQRNRWARGMIQI
FRMDNPLLGRGLTLAQRLCYLSAMMYFFFAIPRAIFLLVPTLYLTFGISVLHGSASLLLA
YVLPHLVMSYYTQSRINGTTRYSFFGEIYDILLSFPLIIPSLAVMISPHHGKFNVTDKGG
TVDKAYFDFHAVRSHILAALFIAFSIAFGITKYFMPEYFSVQLSAVLMNVGWCSFNLILL
VAAICVARETPNKRRTQRLYMALPVLIYQQSGICSRSTLRDISMTGCRLDNIIGGRPLQE
DPVTDIELATDHGPVIIKVNMLENSAYTDHLRFNFGELDINTRRELVRLLFTRPDTWTRE
PHKPDHIIKSFFTVLMCIYDSLTSNSRSSKAKSEAAPSQTVEDVLKEERAAGRS

Enzyme Prediction     

EC	2.4.1.12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	132	303	2.5e-36	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03030	CelA	0.0	5	688	9	708	cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.
PRK11498	bcsA	0.0	7	675	141	803	cellulose synthase catalytic subunit; Provisional
cd06421	CESA_CelA_like	1.75e-119	129	361	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	6.57e-57	89	543	13	430	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	1.40e-33	133	363	2	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJT83155.1	1.60e-280	6	703	2	701
SKC12971.1	1.30e-279	6	703	2	701
APG20439.1	1.30e-279	6	703	2	701
QEM89278.1	1.30e-279	6	703	2	701
ARD58535.1	1.30e-279	6	703	2	701

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	2.02e-180	22	675	167	816	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	1.51e-109	64	589	63	605	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	9.06e-109	64	589	75	617	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	9.28e-109	64	589	76	618	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
6YV7_B	2.12e-10	114	326	28	235	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P58931	4.63e-182	25	657	56	682	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
Q9WX61	7.90e-182	50	678	70	697	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
Q8X5L7	1.17e-181	22	675	167	816	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
P19449	1.18e-180	61	678	81	706	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
Q59167	1.28e-180	34	678	52	696	Cellulose synthase 2 OS=Komagataeibacter hansenii OX=436 GN=acsAII PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	24
28	47
54	71
86	108
378	397
401	423
444	466
491	510
523	545