CAZyme Information: MGYG000001055_00126

Basic Information

• Species: CAG-484 sp000431315
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-484; CAG-484 sp000431315
• CAZyme ID: MGYG000001055_00126
• CAZy Family: GT2
• CAZyme Description: Beta-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469		54286.6	9.1172

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001055	2019920	MAG	Spain	Europe

• Gene Location: Start: 23446; End: 24855 Strand: +

Full Sequence      

MKERIILFTIIFGLGVFVYIFQSYFNTVWGLAFLCLCMTIYALFANLAYTLKKRIMKKYP
QVINEDYKPFVSVLIPAHNEESVISCTVENILCLNYEKFEVIVIDDRSTDNTASVIKDLE
RKYDKVKALIRQQGAFPGKSAVLNDAFKIARGDAVLIFDADATVEPDFLSKLVPELEPKD
VGAVQARKVIRNKNQNFLTRCQNNEYTMDTYFQVSRDSVKGAVELRGNGELIKREAVEDI
GGWNNYTIVDDLDMSTRLHIKGWDVRYCLDAVVYEEGIAYLAPLYKQRRRWLEGTIRRYL
EYSGAALTSKKMSLRARIDMMAYISEFIMPLWFLLEILIRAFKVLAKDASPHMLYSSIII
GIAIGVGFFMAARYALRRYDYMPRLDAMFEALETSIYLFIVWFPLVLFIGFKILFMKKDM
KWGKTAHGLVQEEEASIKAFLKKELEKTKQYTKEYTEKIKQKIAEKGEK

Enzyme Prediction     

No EC number prediction in MGYG000001055_00126.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	69	292	3e-42	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	8.51e-61	31	427	15	424	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.06e-54	73	251	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
PRK11204	PRK11204	1.18e-41	16	418	14	405	N-glycosyltransferase; Provisional
cd06437	CESA_CaSu_A2	8.21e-40	69	294	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06439	CESA_like_1	8.01e-38	40	297	1	250	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38294.1	4.28e-234	46	438	2	394
AGY58232.1	2.17e-71	54	427	49	415
QNH58555.1	1.26e-70	63	427	179	574
QJB28109.1	1.26e-70	63	427	179	574
BAZ42219.1	1.36e-70	56	427	96	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	5.45e-11	57	300	116	380	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	5.71e-11	57	300	128	392	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	5.71e-11	57	300	129	393	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	2.05e-08	69	358	273	575	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5MLZ_A	2.62e-07	71	197	25	149	Dolichylphosphate mannose synthase in complex with GDP and Mg2+ [Pyrococcus furiosus DSM 3638],5MM0_A Dolichyl phosphate mannose synthase in complex with GDP-mannose and Mn2+ (donor complex) [Pyrococcus furiosus DSM 3638],5MM1_A Dolichyl phosphate mannose synthase in complex with GDP and dolichyl phosphate mannose [Pyrococcus furiosus DSM 3638]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8YMK0	8.56e-63	69	427	106	463	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	3.29e-62	69	427	106	463	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
P74165	4.69e-60	69	438	108	477	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
P96587	5.68e-28	69	294	49	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q6G608	5.36e-26	63	294	41	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	22
27	49
320	339
354	376
389	411