CAZyme Information: MGYG000001056_00721

Basic Information

• Species: Prevotella sp900556395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556395
• CAZyme ID: MGYG000001056_00721
• CAZy Family: GT11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272	MGYG000001056_61|CGC1	32213.12	8.5178

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001056	3020119	MAG	Spain	Europe

• Gene Location: Start: 26956; End: 27774 Strand: -

Full Sequence      

MIFVTDKGRMCNNILQYGHVYAWAREHGRKSISMRFCYKYQYFKICHTKGHNFLTYIIAK
YAAKWGLIATVDFNNIAEEAIEKDAAIVARHKHVLIKGWCVRFYDLFIKYKAEIIDLFSF
DKTILDKTQVFMGKKKSNEIRIGVHIRRGDYKTWHNGKYYFEDDVYQDYIQQFQSLFPDK
QLTVYICSNDPALDKQFYRDHLKDAAIIFPQGGQEDDLCLLSECDYLIGAPSTFSLVAAM
YHDLPLYWLKDKEEKLSISSFEKFNHLFRNIR

Enzyme Prediction     

No EC number prediction in MGYG000001056_00721.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	1	240	5.9e-28	0.8659420289855072

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	3.43e-18	2	240	3	239	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11548	NodZ_like	2.28e-06	141	239	167	278	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11296	O-FucT_like	1.34e-04	99	241	36	200	GDP-fucose protein O-fucosyltransferase and related proteins. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11300	Fut8_like	6.15e-04	142	235	187	297	Alpha 1-6-fucosyltransferase. Alpha 1,6-fucosyltransferase (Fut8) transfers a fucose moiety from GDP-fucose to the reducing terminal N-acetylglucosamine of the core structure of Asn-linked oligosaccharides, in a process termed core fucosylation. Core fucosylation is essential for the function of growth factor receptors. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	0.002	142	239	166	263	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB68171.1	4.45e-106	1	271	1	270
QUB65418.1	2.56e-105	1	271	1	270
BBA29461.1	5.95e-104	1	271	1	270
QUB63264.1	1.38e-102	1	271	1	270
ADK96170.1	3.21e-101	1	271	1	270

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999572	0.000394	0.000033	0.000003	0.000001	0.000005

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001056_00721.