CAZyme Information: MGYG000001056_01236

Basic Information

• Species: Prevotella sp900556395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556395
• CAZyme ID: MGYG000001056_01236
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	MGYG000001056_108|CGC1	46174.41	6.978

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001056	3020119	MAG	Spain	Europe

• Gene Location: Start: 5424; End: 6626 Strand: +

Full Sequence      

MKTTICSILCWLVFSTVLMAQDAPLDFSRRVADYLLSHHNHHLSKAQDGHSHIDSYYQEW
RYVNGVLGVAMLHLADVTQENKYERFVKENFDFYFNPDIQQRLRKEYEAGVRDNAWRRFF
SMSSLDDCGAMGAALSELARRYKDERYEKYLGQISHYILHQQERIPELGIYCRGMYGERT
LWLDDLYMCTSFLAHQGSRKGASPDLLQRAAEQVLLFDSLLFDKDKHLYWHCFYYDSTHS
HGTAHWGRANGWAFLAQALLLDCMPEEHPLRNRLLKLFRKRIENIIAYQDAQGMWHQLLD
KPDSYPETSCTAMFVIAIARGVNRGWLDSSFVSVAQQGWKAICSQITPEGQVKNVCMGTG
ISRDLPFYYNRPAPLNDAHGLGAVVQAGIEINNVTTKTTE

Enzyme Prediction     

No EC number prediction in MGYG000001056_01236.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	56	391	1.3e-90	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.17e-66	28	390	2	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.02e-56	59	390	33	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKD05935.1	9.35e-100	29	391	29	409
ALI97836.1	3.00e-98	53	389	69	411
QEC43433.1	3.80e-96	54	400	72	413
QEC56133.1	1.51e-93	11	400	8	405
AYD48298.1	3.49e-93	29	391	34	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	1.37e-59	59	390	83	409	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	6.07e-27	60	391	39	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.56e-26	60	391	29	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	3.43e-23	60	390	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
4XUV_A	4.44e-18	108	386	75	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.32e-26	60	391	39	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	7.11e-21	179	391	198	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O31521	8.77e-19	130	372	77	316	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
L7P9J4	1.65e-15	182	352	161	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000350	0.998943	0.000171	0.000177	0.000172	0.000160

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001056_01236.