CAZyme Information: MGYG000001056_01755

Basic Information

• Species: Prevotella sp900556395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556395
• CAZyme ID: MGYG000001056_01755
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		37052.3	7.8839

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001056	3020119	MAG	Spain	Europe

• Gene Location: Start: 13823; End: 14812 Strand: +

Full Sequence      

MKKLILTILTTLAVIPMLAANKYDNPDTLVVSRDGTGEFRTIDEAIEVCRAFMDYTKVIY
VKKGVYKEKLIIPSWLTNITICGEDRDHTIITWDDHANIKMPIGGLDSETAVKGKPMGTF
RTYTLKVQGSYITLKNITIENNAARLGQAVALHTEGDHILVQNCRLLGNQDTVYTGVAGT
RIAFYDCYIEGTTDFIFGPSIAWFENCEIHSKINSYITAASTPAGQQYGYVFHKCRLTAS
PEATQVYLGRPWRPYAYTLFIDCEMGKHIRPEGWHNWRNAKNEQTARYYEYGNHGPGAST
KGRAPWTHQLSKKEAAKITIANVMGEDCW

Enzyme Prediction     

No EC number prediction in MGYG000001056_01755.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	324	6.2e-102	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.70e-77	30	327	3	298	Pectinesterase.
PLN02773	PLN02773	3.91e-73	29	317	7	289	pectinesterase
COG4677	PemB	1.01e-67	26	323	80	401	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	1.28e-66	19	315	61	352	pectinesterase family protein
PLN02432	PLN02432	6.38e-60	29	329	13	291	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66521.1	1.57e-200	1	329	1	329
AGB28242.1	4.68e-164	1	323	1	314
BCS84477.1	4.12e-163	1	323	1	314
QVJ81978.1	1.50e-162	1	329	1	320
ADE82952.1	1.50e-162	1	329	1	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.01e-39	30	329	6	303	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.06e-39	29	329	9	307	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	6.52e-33	29	326	11	289	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	3.44e-32	29	326	11	289	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	7.80e-28	32	326	12	336	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.29e-57	31	315	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	1.43e-51	28	329	272	572	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q5MFV6	1.10e-50	28	329	276	576	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q42608	2.32e-49	28	329	259	559	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q8VYZ3	2.05e-47	19	315	75	366	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000352	0.998960	0.000202	0.000162	0.000154	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001056_01755.